(data stored in ACNUC7421 zone)

EMBL: CP001349.PE305

CP001349.PE305       Location/Qualifiers
FT   CDS_pept        355074..356669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0313"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: mrd:Mrad2831_3614
FT                   EmrB/QacA family drug resistance transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55357"
FT                   /db_xref="GOA:B8IAW4"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAW4"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ACL55357.1"
FT                   /translation="MSAPDPADSAAGGHNPWLVAVVVAIATFMEVLDTTIANVALRYIS
FT                   GGLAVGPDEAAWVVTSYLVANAIVLTASSFVAKRYGRKAFFMAAIALFTVSSILCGFAW
FT                   SLESLLVFRVLQGLGGGGMAPLAQSILADSFPPEKRGQAFALYGIAIVVAPVVGPTLGG
FT                   WLSDTYSWHWCFLINAPVGVIALGLIHLLVQDPKSAIEERERLRREGVDFDLVGFVLVA
FT                   TFLGSLEVVLDQGQRKDWFGSNLIVTFAVFMGIAFAAIIPWELTRRNPVVDLRLLGRRQ
FT                   FGSCFLVMMATGAILIATTQFLPQLLQDHFGYTATWAGLALSPGGLVTCLMMFVIGRIA
FT                   SVVQPKYLIAGGAAIIAVAMVDLTNLYGDLDFGFFVWSRIAIGIGLPMIFLSITAASYE
FT                   GIAPAQTDQASALINVARNVGGSMGVSLAQNMLAYRQQFHTSRLVEHVVPSEPAYQETL
FT                   RHATDYFATHGASTVDAQSQAFAWIGQQVQTQSAFLAYIDVFWTLAMVSAATIPLAMIL
FT                   TSVKRRGGAPATGH"
     gtgagcgctc ccgaccccgc cgacagcgcc gcgggcgggc acaatccctg gctcgtcgcc        60
     gtggtggtgg cgatcgcaac cttcatggag gtgctcgaca ccacgatcgc caatgtggcg       120
     ctgcgctaca tctcgggcgg cctcgcggtg gggcccgacg aggccgcctg ggtggtgacg       180
     agctacctcg tcgccaacgc catcgtgctc accgcctcga gcttcgtcgc caagcgctac       240
     gggcgcaagg cgttcttcat ggcggcgatc gcgctgttca cggtctcctc catcctgtgc       300
     ggattcgcct ggagcctcga atccctgctg gtcttccggg tgctgcaggg gctcggcggc       360
     ggcggcatgg cgccgctcgc acagtcgatc ctggcggatt ccttcccgcc ggagaagcgc       420
     gggcaggcct tcgcgctcta cggaatcgcc atcgtggtgg cgccggtggt cgggccgacg       480
     ctgggcggct ggctctccga cacctattcc tggcactggt gcttcctgat caacgcgccg       540
     gtcggcgtga tcgccctcgg gttgatccat ctcctggtcc aggatccgaa atcggcgatc       600
     gaggaacgcg agcgcctgcg ccgcgagggc gtcgatttcg atctcgtcgg cttcgtgctg       660
     gtcgcgacct tcctcggctc gctcgaagtc gtgctcgacc aggggcagcg gaaggactgg       720
     ttcggctcga acctcatcgt caccttcgcg gtgttcatgg ggatcgcctt cgcggcgata       780
     atcccgtggg agctcacccg caggaacccg gtcgtcgacc tgcggctgct cggccgccgc       840
     cagttcggct cctgcttcct cgtgatgatg gcgacgggcg ccatcctgat cgccaccacg       900
     cagttcctgc cgcagctgct ccaggatcat ttcggctaca ccgccacctg ggccggcctc       960
     gccctctccc ccggcggcct cgtcacctgc ctgatgatgt tcgtgatcgg tcgcatcgcg      1020
     agcgtcgtgc agccgaaata cctcatcgcc ggcggggccg cgatcatcgc cgtcgcgatg      1080
     gtcgatctca ccaacctcta cggcgacctc gatttcggat tcttcgtctg gtcgcgcatc      1140
     gcgatcggca tcggcctgcc gatgatcttc ctgtcgatca ccgccgcctc ctacgaggga      1200
     atcgccccgg cgcagaccga ccaggcctcg gcgctcatca acgtcgcccg caatgtcggc      1260
     ggctcgatgg gcgtgtcgct cgcccagaac atgctcgcct accggcagca attccatacc      1320
     agccggctcg tggagcacgt cgtgccctcc gagcccgcct accaggagac gctgcggcac      1380
     gccaccgact acttcgccac gcacggcgcc tcgacggtcg acgcgcagag ccaggccttc      1440
     gcctggatcg gccagcaggt gcagacccaa tcggccttcc tggcctatat cgacgtgttc      1500
     tggacgctgg ccatggtgtc ggccgccacc attccgctgg cgatgatcct gacatcggtg      1560
     aagcgccggg gcggcgcgcc cgccaccggg cattga                                1596
//

If you have problems or comments...

PBIL Back to PBIL home page