(data stored in ACNUC7421 zone)

EMBL: CP001349.PE306

CP001349.PE306       Location/Qualifiers
FT   CDS_pept        356747..357694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0314"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   met:M446_2294 cation diffusion facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55358"
FT                   /db_xref="GOA:B8IAW5"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="InterPro:IPR040177"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAW5"
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /protein_id="ACL55358.1"
FT                   /translation="MNQSGSRFVIYAALAGNLAIAATKLMAALYTGSSAMFTEAVHSFV
FT                   DTGNQGLLLYGLHRAARPADDSHNFGHGLELYFWSFVVALMIFALGGAYAIYEGIEKIR
FT                   HPHPIEAAWVNVAVIGTALVFEGLSFLAAWREMRHRFARLPLWRAVARSKDPSTFAVVL
FT                   EDGAALIGLGFALAGIVGSTWLGRPQSDGVASVAIGLLLVATAMVLFRETRSLLTGESA
FT                   SPRLIEQATAILRSDPRVLGVPRLRSLHLGPTTVLLAASLDLDRDLSAEGIRHAVGDLR
FT                   GAIRHGLPGVELLLELREAEAVASSDRGAIPARP"
     gtgaaccagt ccggatcgcg tttcgtcatc tacgccgccc tggccggcaa cctcgccatc        60
     gcggcgacca agctcatggc cgccctctac accgggtcga gcgcgatgtt caccgaggcc       120
     gtacattcct tcgtcgatac gggcaaccag gggctgctgc tctatggcct gcaccgggcc       180
     gcgcggccgg cggacgacag ccacaatttc gggcatgggc tcgaactcta cttctggtcc       240
     ttcgtcgtcg ccctgatgat cttcgcgctc ggcggcgcct acgcgatcta cgagggcatc       300
     gagaagatcc gccaccccca cccgatcgag gcggcctggg tcaacgtcgc ggtgatcggc       360
     accgccctgg tcttcgaggg cctgtccttc ctcgccgcgt ggcgggagat gcgccaccgc       420
     ttcgcgcggc tgccgctctg gcgcgcggtc gcgcgcagca aggacccgag caccttcgcg       480
     gtggtgctgg aggacggtgc ggccctgatc ggcctcggct tcgcgctggc gggcatcgtc       540
     gggagcacgt ggctcggccg gccgcagagc gacggcgtgg cctcggtggc gatcggcctg       600
     ctgctcgtcg cgaccgccat ggtgctgttt cgcgagaccc gcagcctgct gaccggcgag       660
     agcgcctcgc cccgcctgat cgagcaggcc accgccatcc tgcggtccga cccgcgggtc       720
     ctcggcgtgc cgcgtctgcg cagcctccat ctgggaccga cgaccgtgct gctggccgcc       780
     tccctcgacc tcgaccgcga cctgagcgcc gagggcatcc ggcacgccgt cggcgacctg       840
     cgcggggcga tccggcacgg cctgccgggg gtggagctgc tgctggaact ccgcgaggcg       900
     gaggccgtgg cgtcatccga ccggggcgcg atcccggccc gcccgtag                    948
//

If you have problems or comments...

PBIL Back to PBIL home page