(data stored in ACNUC7421 zone)

EMBL: CP001349.PE307

CP001349.PE307       Location/Qualifiers
FT   CDS_pept        357805..359547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0315"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="PFAM: ferredoxin; adenylyl cyclase
FT                   class-3/4/guanylyl cyclase; KEGG: met:M446_2293
FT                   adenylate/guanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55359"
FT                   /db_xref="GOA:B8IAW6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAW6"
FT                   /inference="protein motif:PFAM:PF00111"
FT                   /protein_id="ACL55359.1"
FT                   /translation="MALVMPAARAAGHAPSGSTVRLWRGSVAQRLRLVSGLILFAFAAT
FT                   HFLNHALGLFGIEAMLAFERWRATVTRSVPGTALLAGALLVHAGLALRKLAARRSLRLP
FT                   AWEAAQIVLGLAIPFLLVPHILGTRVANLLYGLNTSYPTVIAHLWPDAIPRQTLLLTLV
FT                   WAHGCLGLHHWLRLSPGYRRAAPWLGVAALILPLAAMLGIAMQGELMERDLAAAARFDA
FT                   ADLAQRWPQYRPPEALTGLGTPIIAGFYAASGLALALGLVRMTAAWRARRIAVTYLDGP
FT                   SVRAADGMTLLEVSRAHRIPHVAVCGGRGRCSTCRVLVTRGTHNLSPPSAQETATLTAI
FT                   GAPPGVRLACQARPRGEVTLMRILRPGTRDRTGDRLGDPDLAGVEREVAILFVDVRGFT
FT                   PLAERKFAFDVVYILNRFFEAAGEPVVKHGGWIGGYAGDGLLALFTHPDGIDAACRAAF
FT                   AAAADIDRAVQALNRQIAAELPAPLRIAMGLHAGPLVLGRLGYGESRPMSAIGPAVNIA
FT                   SRLETHAKAHEVQLAASAAAARRAGIPLDGLRVETVAIRGSEQALEVVSVERAGDLAGR
FT                   LPAA"
     atggctctcg tcatgcctgc cgcgcgcgcc gccggccacg cgccgtccgg atcgaccgtc        60
     cggctgtggc gcggctccgt ggcgcagcgt ctgcgcctcg tctcggggct gatcctgttc       120
     gctttcgcgg cgacgcattt cctcaaccat gcgctcggac tcttcggcat cgaggccatg       180
     ctggccttcg agcgctggcg cgccacggtc actcgctccg tccccggcac ggcgctgctc       240
     gcgggcgcgc tcctcgtgca tgccgggctg gcgctgagaa agctcgcggc gcggcgcagc       300
     ctgcgcctgc ccgcctggga ggcggctcag atcgtcctcg gtctcgcgat cccgttcctg       360
     ctggtgccgc acatcctcgg cacccgggtg gcgaacctgc tctacggcct caacacctcc       420
     tacccgacgg tgatcgccca tctctggccg gacgccatcc cgcgccagac cctcctgctc       480
     actctggtct gggcccatgg ctgcctcggg ctgcaccatt ggctgcggct ctcgccgggc       540
     taccggcgcg ccgccccctg gctcggcgtc gcggcgctga tcctgccgct cgcggccatg       600
     ctcggcatcg ccatgcaggg cgagctgatg gagcgcgacc tcgcggccgc ggcgcggttc       660
     gacgcggcgg atctcgcgca gcgctggccg cagtaccgcc cgcccgaagc gctgacgggc       720
     ctcgggacgc cgatcatcgc tggcttctac gccgcttccg gtctggccct ggcgctcgga       780
     ctcgtccgga tgacggcggc ctggcgggcc cggcgcatcg ccgtcaccta tctggacggg       840
     ccctccgtgc gggctgccga cgggatgaca ctccttgagg tgagccgcgc ccaccgcatc       900
     ccgcatgtgg cggtctgcgg cgggcgggga cgctgctcca cctgccgcgt gctggtcacc       960
     cggggcaccc acaacctctc gccgcccagc gcccaggaga ccgcgacgct gaccgcgatc      1020
     ggggcgccgc ccggcgtgcg gctcgcctgc caggcgcggc cgcgcggcga ggtcaccctg      1080
     atgcggatcc tgcgtcctgg cacccgcgac cgtaccggcg accgcctcgg cgatccggat      1140
     ctcgcggggg tcgagcgcga ggtcgcgatc ctgttcgtgg atgtgcgcgg cttcaccccg      1200
     ctcgccgagc gcaaattcgc cttcgacgtc gtctacatcc tcaaccggtt cttcgaggca      1260
     gccggggagc cggtcgttaa gcatggcggc tggatcggcg gctatgcggg cgatggtctg      1320
     cttgccctgt tcacccatcc ggacgggatc gacgccgcct gccgggcggc ctttgcggca      1380
     gccgccgaca tcgatcgggc cgtgcaggcg ctcaaccggc agatcgccgc cgaactaccg      1440
     gcgccgctgc gcatcgccat gggcctacat gccggccccc tggtccttgg gcgcctcggc      1500
     tacggcgaga gccgtccgat gtcggcgatc ggcccggcgg tgaacatcgc gagccgtctc      1560
     gaaacgcatg ccaaggccca cgaggtgcag ctggccgcct cggccgccgc cgcccgccgg      1620
     gccgggatcc ccctcgatgg cctgcgcgtc gagaccgtgg cgatccgcgg cagcgagcag      1680
     gccctggagg tggtctcggt cgagcgggcc ggcgacctcg ccgggcgcct gccggccgcc      1740
     tga                                                                    1743
//

If you have problems or comments...

PBIL Back to PBIL home page