(data stored in ACNUC7421 zone)

EMBL: CP001349.PE308

CP001349.PE308       Location/Qualifiers
FT   CDS_pept        complement(359663..360781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0316"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   met:M446_2292 lytic transglycosylase catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55360"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAW7"
FT                   /inference="protein motif:PFAM:PF01464"
FT                   /protein_id="ACL55360.1"
FT                   /translation="MGVFPEPAPCADDACRLVPETGTDEGEAAVRWLIPQSAQGRKSRK
FT                   ARVVRTLTGRVLTALGIGLALAGALPQDALAPAAAAHDRADLQVPRRSALPPMGTTEWR
FT                   GLVPVQEKPSTAELIQLDLDRLASEAGEDQTVVFDTLRVPRALVDTILRAAKETEVDPV
FT                   YLMALADKESSFRPNAQAATSSAEGLFQFLTGTWLELVRSFGARHGLTEEAGLIQRHRG
FT                   GLTVPDAAARRRILALRRDPYVASLMAGEMMKRDRARIEQRLGRDLKQTECYVAHLLGV
FT                   ASASRFMQLTQEKPDQPAQTAFRAAARANRSLFFERQGKKTRSLTVAEVYERLDLMIDR
FT                   RLDRFQSAAALADRIDTRRPGDAIPAEATLVP"
     atgggggttt tcccggagcc ggcgccctgc gccgacgacg cgtgccgact cgtgcccgag        60
     actgggacgg acgagggcga ggccgccgtg cggtggctga tcccgcagag cgcgcaggga       120
     cggaaatcgc gcaaggccag ggtggttcgc acgctgacgg gccgggtgct gacggcactc       180
     ggcatcgggc tcgcgctcgc gggcgctttg ccgcaggacg cgctggcgcc ggccgccgcg       240
     gcccatgacc gggccgatct gcaggtgccc cggcgctccg cgctgccgcc catggggacg       300
     accgagtggc gcggcctcgt gccggttcag gagaagccca gcacggcgga gctgatccag       360
     ctcgatctcg accgcctcgc cagcgaggcg ggcgaagacc agaccgttgt cttcgacacc       420
     ctgcgggtgc cccgcgctct cgtcgacacg atcctgcgcg ccgccaagga gaccgaggtg       480
     gatccggtct acctgatggc ccttgccgac aaggaatcga gcttccggcc gaatgcgcag       540
     gccgcgacct cgtcggcgga ggggctgttc cagttcctca ccggcacgtg gctcgagctg       600
     gtccgcagct tcggcgcccg gcatgggttg accgaggagg cgggcctgat ccagcgccac       660
     cgcggaggcc tgaccgtgcc ggatgcggcg gcgcgccgga gaatcctggc gctgcgccgc       720
     gacccctatg tggcgagcct gatggcgggc gagatgatga agcgcgaccg ggcgcggatc       780
     gagcagcgcc tgggccgcga cctgaagcag accgaatgct acgtcgccca tctcctcggg       840
     gtggcgagcg ccagccgctt catgcagctc acccaggaaa agccggacca gccggcccag       900
     accgcgttcc gggccgccgc gcgggcaaac cgaagccttt tttttgaacg ccagggcaag       960
     aagacacgca gcctcacggt ggccgaagtc tacgagagac tcgacctcat gatcgaccgg      1020
     cgcctcgacc gcttccaatc ggccgcggct ctggcggatc gcatcgacac ccgtcgtccg      1080
     ggcgatgcga ttcccgcgga agcaacgctg gttccgtga                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page