(data stored in ACNUC7421 zone)

EMBL: CP001349.PE309

CP001349.PE309       Location/Qualifiers
FT   CDS_pept        361188..362360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0317"
FT                   /product="methyltransferase type 11"
FT                   /note="KEGG: met:M446_2289 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55361"
FT                   /db_xref="GOA:B8IAW8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAW8"
FT                   /inference="similar to AA sequence:KEGG:M446_2289"
FT                   /protein_id="ACL55361.1"
FT                   /translation="MIPFGLVSPQSGEALHHDTPHSLREGRLGPRWPVIDGIPYLRVGR
FT                   DDLVREALGHLDKGAPGHALEQLLADQDDGWTGPRPDPAQLRELVRDLKYVSLREAVAR
FT                   LAWGEVGDYFVHRWTDPTFLAGLALLEAHWNAPLCVFELACGIGHYLRELQGRGVRTSG
FT                   ADVVFAKLWVARHWVVGQRAQLLCFDAGSPHWPIEGTPVDLVLCNDAFSLLKDKSCILD
FT                   CLRRTAGEEGWLALSHIHNSARAGFSAGHAVSAAEIEELFPDGLVYDDAELTHALVEAR
FT                   APAPAEPSALGAVEAFSVVCGPGMRPAPRALVDGLTLPPDGTQLRLNPLYRPMPEGDYA
FT                   IAWPSERYAAEYGPFATYPMRSPGPETIVAGPDTAERARRREFASLPERW"
     gtgattccct tcggacttgt ctcgccgcag agcggcgaag cgctgcacca cgacacgccc        60
     cattccctgc gcgagggccg gctcgggcca cgctggcccg tcatcgatgg cattccctat       120
     ctgcgcgtcg gccgggacga cctcgtccgc gaggcgctcg gccatctcga caagggggcc       180
     cccggccacg ccctcgaaca gctgctcgcc gaccaggacg acggctggac cgggccgcgg       240
     cccgatccgg cacagctgcg cgaactcgtg cgcgacctca aatacgtgtc cctgcgcgag       300
     gcggtggcgc ggctcgcctg gggcgaggtc ggcgactatt tcgtgcatcg ctggacggac       360
     ccgaccttcc tcgccggcct cgccctcctc gaagcgcatt ggaacgcgcc gctctgcgtc       420
     ttcgagctcg cctgcggcat cgggcattat ctgcgcgagc tgcagggccg gggcgtgcgc       480
     acctccgggg cggacgtggt cttcgccaag ctctgggtcg cccggcactg ggtggtgggc       540
     cagcgcgcgc agctcctctg cttcgatgcc ggctcgcccc actggccgat cgagggcacc       600
     cccgtcgacc tcgtgctctg caacgacgcc ttctcccttc tgaaggacaa gagctgcatc       660
     ctcgactgcc tgcgcaggac ggccggcgag gagggctggc tcgcgctcag ccacatccac       720
     aacagcgccc gggccgggtt ctcggcaggc cacgccgtct cggcggccga gatcgaggag       780
     ctgtttccgg atgggctcgt ctacgacgac gccgagctca cgcacgccct cgtcgaggcc       840
     cgcgccccgg cgcccgcgga gccctcggcg ctcggcgcgg tcgaggcctt ctcggtcgtg       900
     tgcggccccg gcatgcgccc ggctccgcgc gcgctcgtcg acgggctgac cctgccgccg       960
     gacggcacgc agcttcggct caaccccctc taccggccga tgccggaggg cgactacgcc      1020
     atcgcgtggc cctccgagcg ctacgcggcg gaatacggcc cgttcgcgac ctacccgatg      1080
     cgctcgcccg gccccgagac gatcgtggcc ggcccggaca ccgccgagcg agcgcggcgg      1140
     cgcgaattcg cgtccctgcc ggagcgctgg tga                                   1173
//

If you have problems or comments...

PBIL Back to PBIL home page