(data stored in ACNUC7421 zone)

EMBL: CP001349.PE31

CP001349.PE31        Location/Qualifiers
FT   CDS_pept        31804..32214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0032"
FT                   /product="DNA-directed RNA polymerase, omega subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, omega subunit;
FT                   PFAM: RNA polymerase Rpb6; KEGG: met:M446_0030 DNA-directed
FT                   RNA polymerase, omega subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55083"
FT                   /db_xref="GOA:B8IT21"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8IT21"
FT                   /inference="protein motif:TFAM:TIGR00690"
FT                   /protein_id="ACL55083.1"
FT                   /translation="MARVTVEDCIDKVENRFELVLLAGHRARLLSSGAPLTVDRDRDKN
FT                   PVVALREIADQTITPDDLKEQLIHSLQKYVEVDEPEAEAVPLLSSSPAAAAVAPQSSGD
FT                   DGDIQFDRMSEEDLLRGLENLAPPTETEDEGD"
     atggctcgcg tcaccgttga agattgcatc gacaaggtcg agaaccggtt cgagctcgtt        60
     ctgctcgccg gccatcgggc ccggctgctc tcgtccggcg cgcccctcac cgtcgaccgc       120
     gaccgcgaca agaacccggt cgtcgcgctg cgcgagatcg ccgaccagac catcacgccg       180
     gacgacctca aggagcagct gatccactcg ctgcagaaat acgtcgaggt cgacgagccg       240
     gaggcggagg ccgtgccgct cctgtcgagc tcgcccgctg cggcggccgt ggcgccgcaa       300
     tcctccggcg acgacggcga catccagttc gaccgcatga gcgaggagga cctgctgcgc       360
     ggcctggaga acctcgcgcc gccgaccgag accgaggacg agggcgacta a                411
//

If you have problems or comments...

PBIL Back to PBIL home page