(data stored in ACNUC7421 zone)

EMBL: CP001349.PE310

CP001349.PE310       Location/Qualifiers
FT   CDS_pept        complement(362424..363380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0318"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: met:M446_2283 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55362"
FT                   /db_xref="GOA:B8IAW9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAW9"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL55362.1"
FT                   /translation="MRNLSLKQLQAVAAIARLGTMTRAAQELNVTPAALTARIKALEDE
FT                   AGLLLFDRTSAGLKPTDAGREMLWAIDSINTVLETCAERLKALRGGSGGRVAVGVVSTA
FT                   KYFAPQIISGFVHQHPSIEIDLVVGNRGATLESIRDYKVDLAVMGRPPRDFPISAESFG
FT                   PHPLVVIAAPGHRFAGRVGITRAELAEEPFLVREYGSGTRTVFEEFMTGVMIKRARFGI
FT                   DSGSNETIKQTVMAGLGIALISGHTVAAEVASRRLIILDVEGLPIRREWFVVRRADKVL
FT                   SPAARSLWDYIVTEGASWLPTLPLRPPGAPAGATAAA"
     atgcgtaacc tctccctcaa gcagcttcag gccgttgcgg cgatcgcccg gctcgggacg        60
     atgacccgcg ccgcacagga gctgaacgtc accccggcgg ctctcaccgc ccgcatcaag       120
     gccctggagg acgaggcggg cctgctgctg ttcgaccgca ccagcgcggg tctgaagccc       180
     acggacgccg ggcgcgagat gctgtgggcg atcgacagca tcaacacggt gctggagacc       240
     tgcgcggaac gcctgaaggc cctgcgcggc ggcagcggcg gccgggtcgc ggtcggcgtc       300
     gtctcgaccg ccaagtactt tgcgccgcag atcatcagcg gcttcgtgca ccagcacccg       360
     tccatcgaga tcgacctcgt ggtcggcaac cggggggcga cgctcgaatc gatccgggac       420
     tacaaggtcg accttgccgt catgggacgg ccgccgcggg actttccgat ctcggcggag       480
     tcgttcgggc cgcacccgct ggtggtgatc gccgcgcccg ggcaccgctt cgccggccgt       540
     gtcggcatca ccagggcgga actcgccgag gagccgttcc tggtgcgcga gtacggctcg       600
     ggcacccgga cggtgttcga ggagttcatg acgggcgtga tgatcaagcg cgcccggttc       660
     ggcatcgaca gcggctcgaa cgagaccatc aagcagaccg tgatggcggg tctcgggatc       720
     gcgctgatct cgggccacac ggtcgccgcc gaggtggcga gccgccgctt gatcatcctc       780
     gacgtcgagg gcctgccgat ccgccgcgag tggttcgtgg tgcggcgcgc cgacaaggtg       840
     ctgagcccgg ctgcgcgctc cctgtgggac tacatcgtca cggagggggc gtcctggctg       900
     cccacgctgc cgctgcggcc tccgggcgcg ccggccggag cgaccgcggc cgcatag          957
//

If you have problems or comments...

PBIL Back to PBIL home page