(data stored in ACNUC7421 zone)

EMBL: CP001349.PE311

CP001349.PE311       Location/Qualifiers
FT   CDS_pept        363581..364573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0319"
FT                   /product="Inositol phosphatase/fructose-16-bisphosphatase"
FT                   /EC_number="3.1.3.11"
FT                   /note="PFAM: Inositol
FT                   phosphatase/fructose-16-bisphosphatase; KEGG: met:M446_2282
FT                   inositol phosphatase/fructose-16-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55363"
FT                   /db_xref="GOA:B8IAX0"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAX0"
FT                   /inference="protein motif:PFAM:PF00316"
FT                   /protein_id="ACL55363.1"
FT                   /translation="MVVGTRLEACLASEGAGGDRAVASVLTALALAAAETSTLLRNGGH
FT                   DSGPGPNGLEGAVRSRFTAALRDAPTALLALREAEHDEVLDPAASLAVALSPLDGADNL
FT                   AGNLPAGTIFSLRPAGDGAPFRQPGRSQVAAGFVTYGPRTDLALTWGRGVRIFTLDPAS
FT                   GAFHLTRDAVTIPPTSPLYAVDAANARFWEAPVRAFVDDCLRGSEGPRGQDFAMGWSTS
FT                   LAAGAHHILARGGVQLMPGETRRGCANGQTRLVHEAAAIALVMEAAGGAATDGRDGPIL
FT                   DLKALDLHQRTPFVFGSAEEVACVGKYHDGRRHTGARSPLFGQRGLLRA"
     atggtggtcg ggactcgcct cgaggcctgc ctcgccagcg agggggctgg cggcgatcgt        60
     gcggtggcgt ccgtgctgac ggctctggcc ctcgcggccg ccgagacgag caccctcctc       120
     cggaatggcg gccacgattc cggccccggc ccgaacggcc tcgaaggcgc ggtgcggtcg       180
     cggttcacgg ccgccctgcg cgatgcgccg acggcgctcc tcgccctgcg ggaggcggag       240
     cacgacgagg tgctcgaccc ggcggcctcc ctcgcggtcg ccctctcgcc gcttgacggg       300
     gccgacaatc tcgccggcaa cctgcccgcc ggaacgatct tctccctgcg cccggccggc       360
     gacggggccc ccttccgtca gccgggccgg tcgcaggtcg cggccggctt cgtcacctac       420
     gggccgcgga ccgacctcgc gctgacctgg ggccggggcg tccgcatctt caccctcgat       480
     ccggcctcgg gcgcgttcca tctcacccgc gacgcggtga cgatcccgcc gacgagcccg       540
     ctctacgccg tcgatgccgc caatgcccgc ttctgggagg cgccggtgcg cgccttcgtg       600
     gacgattgcc tgcgcggctc cgaggggccg cggggacagg atttcgccat gggctggagc       660
     acctcgctcg ccgccggcgc gcaccacatc ctggcgcgcg gcggcgtgca gctgatgccg       720
     ggcgagaccc gccgcggctg cgccaacggc cagacccgcc tcgtgcacga ggcggccgcg       780
     atcgcgctcg tcatggaggc ggcggggggc gccgcgacgg acgggcgcga tggcccgatc       840
     ctcgacctca aggccctgga cctgcaccag cgcaccccct tcgtgttcgg ctccgccgaa       900
     gaggtggcct gcgtcggcaa gtatcatgac ggccgccgcc ataccggcgc ccgctcgccg       960
     ctcttcggtc aacggggcct tctgcgcgcc tga                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page