(data stored in ACNUC7421 zone)

EMBL: CP001349.PE312

CP001349.PE312       Location/Qualifiers
FT   CDS_pept        364666..365526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0320"
FT                   /product="phosphoribulokinase/uridine kinase"
FT                   /EC_number="2.7.1.19"
FT                   /note="PFAM: phosphoribulokinase/uridine kinase; KEGG:
FT                   met:M446_2281 phosphoribulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55364"
FT                   /db_xref="GOA:B8IAX1"
FT                   /db_xref="InterPro:IPR006082"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAX1"
FT                   /inference="protein motif:PFAM:PF00485"
FT                   /protein_id="ACL55364.1"
FT                   /translation="MSALHPIISVTGSSGAGTTSVRNTFEQIFRRESVTAVYIEGDAFH
FT                   SMDRATMRKAMAAEPTLSHFGERANLLPELEAVFRAYAESGRGRTRHYIHDRNDAERWG
FT                   GEPGTFSEWEEFDAESDLLFYEGLHGAVHNERINIAQYADLKIGVVPVINLEWIQKLHR
FT                   DRATRGYSTEAVTDVILRRMPDYVNVICPQFTNTDINFQRIPTVDTSNPFIARWIPTAD
FT                   ESMVVIRFRDPKGIDFPYLISMIAGSFMSRANSVVIPGGKLDLAMQLILTPMILQLVER
FT                   RRRLL"
     atgtccgccc tccacccgat catctcggtg acgggctcct cgggagccgg caccacctcg        60
     gtgcgcaaca ccttcgagca gatcttccgc cgcgagagcg tcacggcggt ctacatcgag       120
     ggcgacgcct tccactccat ggaccgcgcc acgatgcgca aggccatggc cgcggagccg       180
     acgctgagcc atttcggcga gcgggcgaac ctgctgcccg aactcgaagc ggtcttccgc       240
     gcttacgcgg aatccggccg cggccgcacc cgccactaca tccacgaccg caacgatgcc       300
     gagcgctggg gcggcgagcc cggcaccttc tcggaatggg aggagttcga cgcggaatcc       360
     gacctcctct tctacgaggg cctgcacggc gcggtgcaca acgagcgcat caacatcgcg       420
     caatatgccg acctcaagat cggcgtcgtg ccggtgatca acctcgaatg gatccagaag       480
     ctgcaccggg accgggccac gcgcggctac tcgaccgagg cggtcaccga cgtgatcctg       540
     cgccggatgc ccgactacgt gaacgtcatc tgcccgcaat tcaccaacac ggacatcaac       600
     ttccagcgca tcccgacggt cgacacctcg aacccgttca tcgcccgctg gatcccgacc       660
     gccgacgaat ccatggtggt gatccgcttc cgcgacccga agggcatcga tttcccctac       720
     ctgatctcga tgatcgccgg cagcttcatg tcgcgcgcca attcggtggt catccccggc       780
     ggcaagctcg acctcgcgat gcagctcatt ctgacgccga tgatcctgca gctcgtggag       840
     cggcggcggc gcctgctctg a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page