(data stored in ACNUC7421 zone)

EMBL: CP001349.PE313

CP001349.PE313       Location/Qualifiers
FT   CDS_pept        365602..366396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0321"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; AraC protein arabinose-binding/dimerisation;
FT                   KEGG: bcj:BCAM2003 AraC family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55365"
FT                   /db_xref="GOA:B8IAX2"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAX2"
FT                   /inference="protein motif:PFAM:PF02311"
FT                   /protein_id="ACL55365.1"
FT                   /translation="MHRAEQFRSAVTGIEAVALASRRHFPRHAHDHFGIGVMRFGAHRS
FT                   WSGIGPVEAGAGDVITVNPGEMHDGHPVDDRGRGWTMLYLDPGLMAREMRDETPGPFEI
FT                   TRPAVSDPGLADSLTRLFAGMIAPKPDLLALEERLLRTLMLLLRRYANRFPPVREASPP
FT                   VARALRRLNEAPEIPVTLGELAALSGVSRFQLLRGFSREVGTTPHSYLIQRRVRLARQL
FT                   LAAGQRPAEAAIAAGFADQSHMTRAFVRQFGVTPARYRSAVA"
     atgcaccggg ccgagcagtt ccgatcggcc gttacgggga tcgaggcggt tgcgctggcc        60
     tccaggcgtc acttcccccg ccatgcgcat gatcacttcg gaatcggcgt aatgcgattc       120
     ggcgcgcacc ggtcctggag cggcatcggg cccgtggagg cgggtgccgg ggacgtgatc       180
     acggtcaatc ccggggagat gcacgacggc cacccggtgg atgatcgggg acggggctgg       240
     acgatgctct atctcgaccc cggtctcatg gcccgagaga tgcgggacga gacacccggc       300
     cccttcgaga tcacccggcc ggccgtttcc gatccggggc tggccgatag cctcacgcgc       360
     ctgttcgccg ggatgatcgc accgaagccg gaccttctcg ccctcgaaga gcgattgctg       420
     cggacgctga tgctccttct gcgccggtac gcgaaccggt tcccgccggt tcgcgaagca       480
     tcgcctccgg tcgcccgcgc gctccggcgc ctgaacgagg ctcccgagat cccggtcacg       540
     ctcggcgagc tggccgccct gtcgggggtg agccggttcc agctcctgcg cggcttctcc       600
     cgcgaggtcg gcacgacgcc gcattcctac ctcatccagc ggcgggtccg cctcgctcgg       660
     cagcttctgg ctgcgggaca gcgccccgcc gaggcggcga tcgcggccgg cttcgccgat       720
     cagagtcaca tgacccgcgc cttcgttcgc cagttcggcg tcacccccgc ccggtatcgg       780
     tccgccgtgg cctga                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page