(data stored in ACNUC7421 zone)

EMBL: CP001349.PE314

CP001349.PE314       Location/Qualifiers
FT   CDS_pept        366476..367282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0322"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase; methyltransferase
FT                   small; Methyltransferase type 11; Methyltransferase type
FT                   12; KEGG: gur:Gura_0628 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55366"
FT                   /db_xref="GOA:B8IAX3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAX3"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACL55366.1"
FT                   /translation="MDQHYVHGYDGVESLRLHDQASTLEDLLHGDTAYPGGSTILEAGC
FT                   GVGAQTVALARRNPGVKITCVDVSARSLMTAEAHVAAAGLPRPDFRQADLHALPFSEAS
FT                   FDHVFVCFVLEHLARPARALAELRRVVKPNGTITVIEGDHGSTFFHPDDSDARAVIRCQ
FT                   VDLQRAAGGDALIGRRLFPLLAQSGFDAVRVSPRLVYVDASRPNLAEGFVRKTFTAMIA
FT                   GIRSPATAANLIDGATFDSGIRALLRTSEADGVFCYTFFKAVGRKA"
     atggatcagc actatgttca cgggtacgac ggcgtggaga gcctgcgcct gcacgatcag        60
     gcgagcacgc tggaggacct gcttcacggc gacaccgcct acccgggcgg cagcacgatc       120
     ctcgaagcgg gctgcggcgt gggcgcccag actgttgcgt tggctcggag aaacccgggc       180
     gtgaagatca cctgcgtcga tgtctcggcg cgatctctca tgacggcgga agcgcatgtg       240
     gcagcggcgg gccttcctcg tccggatttc cgccaggccg accttcacgc gctgcctttc       300
     agtgaggcgt ccttcgatca cgtcttcgtc tgcttcgtcc tcgagcatct cgctcggccg       360
     gccagggcgc tggccgagtt gcggcgcgtg gtgaagccga atggcaccat cacggtcatc       420
     gagggtgacc acggctccac attcttccat cccgatgaca gcgacgcccg agcggtcatc       480
     cgatgccaag tggatctcca gcgggcggcg ggcggggatg cgctgatcgg ccggcgtctc       540
     tttccgttgc tggcgcaatc cggcttcgat gccgtccgcg tctcgccacg cctcgtctac       600
     gtggatgcaa gtcgcccaaa cctcgccgaa ggcttcgtcc ggaagacgtt cacggccatg       660
     atcgcgggta tccgcagccc cgcaaccgct gcgaacctga tcgacggcgc cacattcgac       720
     tccgggatca gagcgctcct ccggacatcc gaagccgacg gcgttttctg ctacaccttc       780
     ttcaaggccg ttggccggaa agcgtga                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page