(data stored in ACNUC7421 zone)

EMBL: CP001349.PE315

CP001349.PE315       Location/Qualifiers
FT   CDS_pept        367377..368153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0323"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: met:M446_2280 HAD family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55367"
FT                   /db_xref="GOA:B8IAX4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAX4"
FT                   /inference="protein motif:TFAM:TIGR01509"
FT                   /protein_id="ACL55367.1"
FT                   /translation="MLKALIFDVDGTLAETEPVHRESFNRAFARFGLPFSWDEALYADL
FT                   LQVTGGKERLLHYLAHYRPPGVEGIFPLLPEIYAAKTRAYVELVAAGRLVPRPGILRLV
FT                   AEAKAAGLRLAIATTSHADNVAALIAALFRTGRGPFDLVAAGDAVTAKKPSPAVYDFAL
FT                   ARLGVAATEAVAFEDSTNGVRAARAAGLPVVATPSQALPVDDLGEAPAIVSDLGEPGLP
FT                   HRLLAGDPWPAGMVSVDALHGWHARQAAACPVEGMA"
     gtgctcaagg ctctgatctt cgacgtggac ggcacgctgg ccgagaccga gccggtacac        60
     cgggaatcgt tcaaccgcgc cttcgcgcgg ttcggcctgc ccttctcctg ggacgaggcg       120
     ctctatgcgg atctcctcca ggtgacgggc ggcaaggagc ggctgctgca ctacctcgcc       180
     cattaccgcc cgccgggtgt cgagggcatc tttccgctcc tcccggagat ctacgccgcc       240
     aagacccggg cctatgtgga actggtggcg gccgggcggc tcgtgccgcg tcccggcatc       300
     ctgcggctcg tcgccgaggc gaaggcggcg ggactccggc tcgccatcgc gacgacgagc       360
     catgccgaca atgtcgcggc cctcatcgcc gccctgttcc ggacgggacg cgggccgttc       420
     gacctggtgg cggcgggcga cgcggtgacg gccaagaagc catccccggc ggtctacgac       480
     ttcgccctcg cccggctcgg cgtcgcggcg acggaggcgg tcgcgttcga ggattcgacc       540
     aacggcgtgc gcgccgcgcg ggcggcgggg ctgcccgtcg tcgcgacgcc gagccaggcg       600
     ctgccagtag acgatctcgg cgaggcgccg gccatcgtgt ccgatctcgg cgagccgggt       660
     ctcccgcacc ggctgctggc cggcgatccc tggcccgcag gcatggtctc ggtcgacgcc       720
     ctgcacgggt ggcatgcccg ccaggccgcc gcttgtcctg tcgaagggat ggcgtaa          777
//

If you have problems or comments...

PBIL Back to PBIL home page