(data stored in ACNUC7421 zone)

EMBL: CP001349.PE316

CP001349.PE316       Location/Qualifiers
FT   CDS_pept        368195..369391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0324"
FT                   /product="signal transduction histidine kinase"
FT                   /note="PFAM: GAF domain protein; ATP-binding region ATPase
FT                   domain protein; histidine kinase
FT                   dimerisation/phosphoacceptor; KEGG: met:M446_2279 signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55368"
FT                   /db_xref="GOA:B8IAX5"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011102"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAX5"
FT                   /inference="protein motif:PFAM:PF07568"
FT                   /protein_id="ACL55368.1"
FT                   /translation="MCGFLSMSGEWSNRDMAESGRAELPYRLRQQGFLGSLTRMLLQSR
FT                   DLGAFLQRACDAAAEGLGAPCAHVLEYRPHDHDFLIRAATGWPEGTIGATCPAADEAAP
FT                   AAYAFRTGAGVLANGLPDTAGFRLPDPFGGAGIRHAVNVPIVLGEDGRRAYGVLEVCGR
FT                   EDPGFDRADQDFLAGLAGLIGLAVERSHADQRLRDALDHQALLAREMSHRVKNSLGVVA
FT                   GLLRLQARDTHSEEVRYALEDAGARIATVAQVHDHLWRGLHVGTVEVSGFVRELVSKLQ
FT                   EAAPGHPLRCEADPRVIAADQAIPIGLMVNELVTNAVKYAYPGGTGPVEVTVAVQGNRL
FT                   RVDVSDHGVGLPPGFDVHSRQRSLGLKIINNLTRQLDGRLSAEPNNPGARFVLEMPLG"
     atgtgtggat tcctctcgat gtcgggtgag tggtcgaacc gggacatggc ggaatccggg        60
     cgcgcggaac tgccctatcg gctccggcag caaggtttcc tcggatccct cacccggatg       120
     ctcctccaga gccgcgacct cggcgcgttc ctgcagcggg cctgcgacgc cgccgccgaa       180
     ggtctgggcg ccccctgcgc gcatgttctc gaataccgcc cgcacgatca cgactttctg       240
     atccgggccg cgaccggctg gccggagggc accatcgggg cgacctgccc ggccgccgac       300
     gaggccgcgc cggccgccta cgccttccgc accggcgcgg gcgtcctggc gaacgggttg       360
     cccgacaccg cgggcttccg cctgcccgac cctttcgggg gagcgggcat ccgccacgcg       420
     gtcaacgtgc cgatcgtgct cggggaggac ggccggcggg cctacggcgt gctggaggtc       480
     tgcggccggg aggatccggg cttcgaccgc gccgatcagg acttcctcgc gggcctcgcg       540
     gggctgatcg gcctcgcggt ggagcgctcc cacgcggatc agcgcctgcg cgatgcgctc       600
     gaccatcagg cgctgctcgc gcgcgagatg agtcaccggg tcaagaacag cctcggcgtg       660
     gtcgcgggcc tgctgcgtct ccaggcgcgc gatacccatt cggaggaggt gcgctacgcc       720
     ctggaggatg cgggcgcccg catcgccacg gtggcgcagg tgcacgacca tctctggcgg       780
     gggctgcatg tcggcaccgt ggaggtctcg ggcttcgtcc gcgagttggt gagcaagctg       840
     caggaggccg cgccgggcca tccgctccga tgcgaggccg acccgcgggt gatcgccgcc       900
     gatcaggcga ttccgatcgg cctcatggtc aacgaactcg tcaccaacgc cgtcaaatac       960
     gcctatccgg gcggcaccgg cccggtcgag gtcaccgtgg cggtgcaggg caatcggctg      1020
     cgtgtcgacg tgtcggatca cggcgtcggc ctgcctcccg gcttcgacgt gcattcccgc      1080
     cagcgcagcc tcgggctcaa gatcatcaac aacctcaccc gccagctcga cggccggctg      1140
     tcggccgagc cgaacaatcc gggcgcgcga ttcgtgctgg agatgccgct cggctga         1197
//

If you have problems or comments...

PBIL Back to PBIL home page