(data stored in ACNUC7421 zone)

EMBL: CP001349.PE317

CP001349.PE317       Location/Qualifiers
FT   CDS_pept        369574..370515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0325"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; NMT1/THI5 like domain protein;
FT                   KEGG: met:M446_2277 NMT1/THI5-like domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55369"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAX6"
FT                   /inference="protein motif:PFAM:PF09084"
FT                   /protein_id="ACL55369.1"
FT                   /translation="MRAAAIGMGLAALLAAPAFAQGTKVTIGMSGWTGFAPLTLAKEAG
FT                   IFQKNGLDVTIKKIPQASRHLAIRSGDVQCAATTVETWVVWNANGVPAKQIFQLDKSYG
FT                   ADGLVVRNDIAAIKDLKGKTVAASVPGTAPYFTLAWMLKQNGLSLKDVKVVNLEPGPAA
FT                   QAFIAGQNDAAVTYEPYLSSVRAAPQAGKIIATTLDYPMIMDTFGCTPDFLNQNPKAAK
FT                   ALADSYFEALDLIAKDQAKSFEIMGADVKQTGEAFAASAKFLRWQDRAANKAFFSGGLQ
FT                   KFSAEAADLLLEIGIIKQKPDIDSLADARFIQ"
     atgagagcgg ctgcgatcgg gatgggcctt gccgcgctgc tggcggctcc ggctttcgcg        60
     caagggacca aggtcacgat cgggatgagc ggctggacgg gcttcgctcc gctcaccctc       120
     gccaaggagg ccgggatctt ccagaagaac ggcctcgacg tcaccatcaa gaagattccc       180
     caggcgagcc gccatctcgc catccgctcg ggcgacgtgc aatgcgccgc gacgaccgtc       240
     gagacctggg tggtctggaa cgccaacggc gtgccggcga agcagatctt ccagctcgac       300
     aagtcctacg gcgccgacgg gctggtcgtg cgcaacgaca tcgcggcgat caaggacctc       360
     aagggcaaga cggtcgcggc ctcggttccg ggcaccgcgc cctacttcac cctcgcctgg       420
     atgctgaagc agaacggcct gtccctgaag gatgtgaagg tggtcaacct ggagccgggc       480
     cccgccgccc aggccttcat cgccggccag aacgacgcgg cggtgaccta cgagccctat       540
     ctctcctccg ttcgcgccgc gccgcaggcc ggcaagatca tcgccacgac cctcgactac       600
     ccgatgatca tggatacgtt cggctgcacg ccggatttcc tgaaccagaa cccgaaggcc       660
     gccaaggcgc tcgccgacag ctacttcgag gccctcgacc tcatcgccaa ggatcaggcc       720
     aagtccttcg agatcatggg cgccgacgtg aagcagaccg gagaggcctt cgccgcctcg       780
     gcgaaattcc tgcgctggca ggaccgggcc gccaacaagg ccttcttctc cggtgggctg       840
     cagaagttct cagccgaagc ggccgacctg ctgctcgaga tcggcatcat caagcagaag       900
     ccggacatcg acagcctcgc ggacgcccgc ttcatccagt ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page