(data stored in ACNUC7421 zone)

EMBL: CP001349.PE318

CP001349.PE318       Location/Qualifiers
FT   CDS_pept        370521..371294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0326"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: met:M446_2276
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55370"
FT                   /db_xref="GOA:B8IAX7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAX7"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL55370.1"
FT                   /translation="MRPLQPVGRVPRAVLGVGFFVLFVLAWAVATLGGFVPVTFLADPL
FT                   TMLQDGWLLLTRFGFLSDIGVTVWRVVGGFLLAAVVAVPLGILMGAYKPVEAFFEPFVS
FT                   FARYLPASAFVPLLILWAGIGEMQKLLVIFIGSVFQIVLMVAVSVGQVRRDLVEAAYTL
FT                   GASDTGIIRRVLIPATAPDIAEILRLVLGWAWTYVIVAELIGSSSGIGHMIIESQALLA
FT                   TGQIIFGIIVIGLIGLASDFLFKAVNRQVFRWKLA"
     atgcgtccgc tccagccggt cggccgcgtc ccgcgcgctg tcctcggcgt cggcttcttc        60
     gtcctgttcg tgctggcctg ggctgtcgcc accctcggcg gcttcgtgcc ggtgacgttc       120
     ctcgccgacc cgctgaccat gctgcaggac ggctggctcc tgctgacgcg gttcggcttc       180
     ctgtcggata tcggcgtcac cgtctggcgg gtggtcggcg gcttcctgct cgcggctgtc       240
     gttgcggtgc ccctcggcat cctgatgggc gcctacaagc cggtcgaagc cttcttcgag       300
     cccttcgtgt ccttcgcccg ctacctgccg gcctccgcct tcgtgccgct gctgatcctc       360
     tgggccggga tcggcgagat gcagaagctc ctcgtcatct tcatcggctc ggtgttccag       420
     atcgtcctga tggtggcggt ctcggtgggg caggtgcggc gcgacctcgt ggaggcggcc       480
     tacacgctcg gcgccagcga caccggcatc atccgccggg tcctgatccc ggccaccgcc       540
     cccgacatcg ccgaaatctt gcgcctcgtg ctcggctggg cctggaccta cgtcatcgtc       600
     gccgagctga tcggctcctc ctcgggcatc ggacacatga tcatcgagag ccaggcgctg       660
     ctggcgacgg gccagatcat cttcggcatc atcgtcatcg gcctgatcgg cctcgcctcg       720
     gacttcctgt tcaaggcggt caaccggcag gtcttccggt ggaagctcgc gtga             774
//

If you have problems or comments...

PBIL Back to PBIL home page