(data stored in ACNUC7421 zone)

EMBL: CP001349.PE319

CP001349.PE319       Location/Qualifiers
FT   CDS_pept        371306..372100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0327"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: met:M446_2275 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55371"
FT                   /db_xref="GOA:B8IAX8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAX8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55371.1"
FT                   /translation="MSAPAAVAIEGVSRVFPGMGGRAPLRALDPTDLTVAANDFITILG
FT                   PSGCGKSTLLRIVAGLDLPSSGRVLVGGREVRRAGPDRGMVFQSYTLFPWLTVAENIAF
FT                   GLRERGVPMSERREIVAAYIDKVGLRGFEGHYPKQLSGGMQQRTAIARALANDPAILLL
FT                   DEPFGALDNQTRGLMQELLLGIWERERKTVIFVTHDIEEAVFMASRVVVMTARPGRIKA
FT                   DVPVDLAHPRHYTVKTSPAFSDLKARLTEEIRSEAVLAALEH"
     atgagcgcgc ccgccgccgt cgcgatcgag ggcgtgtcgc gggtctttcc cgggatgggc        60
     gggcgggccc ccttacgcgc cctcgacccc accgacctca cggtcgcggc caacgacttc       120
     atcaccatcc tgggcccttc gggttgcggg aaatcgaccc tcctgcgcat cgtcgccggg       180
     ctcgatctcc cgagttcggg ccgcgtcctc gtcggcgggc gggaggtgcg ccgggcgggg       240
     ccggaccggg gcatggtgtt ccagtcctac accctgtttc cctggctcac cgtcgcggag       300
     aacatcgcct tcggcctgcg cgagcgcggc gtgccgatga gcgagcgccg cgagatcgtc       360
     gcggcctata tcgacaaggt gggcctgcgc ggcttcgagg gccactaccc caagcagctc       420
     tccggcggca tgcagcagcg caccgcgatc gcccgcgcgc tcgccaacga tccggcgatc       480
     ctcctgctcg acgagccctt cggcgccctc gacaaccaga cccgcggcct gatgcaggag       540
     ctgctcctcg ggatctggga gcgcgagcgc aagacggtga tcttcgtcac ccatgacatc       600
     gaggaggcgg tgttcatggc ctcgcgggtg gtggtgatga ccgcccgtcc cggccgcatc       660
     aaggccgacg tcccggtcga cctcgcgcat ccgcgccact acaccgtgaa gacgagcccc       720
     gccttctcgg acctcaaggc ccggctgacg gaggagatcc gcagcgaggc cgtgctggcc       780
     gcgctggagc actga                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page