(data stored in ACNUC7421 zone)

EMBL: CP001349.PE32

CP001349.PE32        Location/Qualifiers
FT   CDS_pept        32653..34866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0033"
FT                   /product="(p)ppGpp synthetase I, SpoT/RelA"
FT                   /EC_number="2.7.6.5"
FT                   /note="KEGG: met:M446_0031 (p)ppGpp synthetase I,
FT                   SpoT/RelA; TIGRFAM: RelA/SpoT family protein; PFAM: amino
FT                   acid-binding ACT domain protein; TGS domain protein;
FT                   metal-dependent phosphohydrolase HD sub domain; RelA/SpoT
FT                   domain protein; SMART: metal-dependent phosphohydrolase HD
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55084"
FT                   /db_xref="GOA:B8IT22"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT22"
FT                   /inference="protein motif:TFAM:TIGR00691"
FT                   /protein_id="ACL55084.1"
FT                   /translation="MMRQYELVERVKAYNPAADEAMLNRAYVYAMRAHGSQMRASGDLF
FT                   FAHPLEVAAILTELRVDDATIVAAVLHDTVEDTAATLEEINRTFTPEIGTLVDGLTKIK
FT                   RLDLVSKQAAQGENFRKLLLAIAADVRVLLVKLADRLHNMRTLHHMPPEKRVRIAQETL
FT                   DIYAPLAGRMGMQELREELEDLSFRNLKPDVYATISKRLDDLTTKSESLVESIERDLVQ
FT                   RLAAKGITAQVRGRQKRPYSIWSKMERKSVAFEQLSDIFGFRVVVDSVDTCYRALGVVH
FT                   TTWPMVPGRYKDYISTPKQNDYRSIHTTVIGPKSQRVELQIRTAEMDEVAEYGIAAHAL
FT                   YKDGSPHLATESGAYQWLRRTIELLAEGDSPEEFLEHTKLELFQDQVFCFTPKGRLIAL
FT                   PRGATPIDFAYAVHTELGNAAVGAKINGRIAPLLTELQNGDEVEIVRADGQTPPAAWES
FT                   LVVTGKARAAIRRATRSAVRRQYAGLGRQILDRAFERAGKNFSDEKLRGALPRLARTSA
FT                   EDVFAAVGRGEMFSGDVVKAVYPDYKDERRSQSAATGPKPHVNGAGRLSLDKDQTVRLT
FT                   WPGKGRGEEDEGAIPIRGLDRDLPVRFAPEGGAVPGDRIVGILTPGEGVTIYPIQSPAL
FT                   AAFDNEPDRWLDVRWDVDGGSNQRFPARIALQSINEPGSFAQIAQVIADHDGNIDNISM
FT                   KRRSQDFTDVLIDLSVWDLKHLNAIVSELRAKRVVSRVERVNG"
     atgatgcgcc agtacgaact cgtcgagcgg gtgaaggcct acaatcccgc cgccgacgag        60
     gcgatgctca accgggccta cgtctatgcc atgcgggcgc acggctcgca gatgcgggca       120
     tccggcgacc tgttcttcgc ccatccgctc gaagtcgcgg cgatcctcac cgagctgcgc       180
     gtcgacgatg ccaccatcgt ggcggcggtg ctgcacgaca cggtcgagga cacggctgcc       240
     accctggagg agatcaaccg caccttcacg cccgagatcg gcaccctcgt cgacggtctc       300
     accaagatca agcgcctcga cctcgtctcc aaacaggcgg cgcagggcga gaattttcgc       360
     aagctgctgc tcgccatcgc ggcggacgtg cgggtgctgc tggtcaagct cgccgaccgg       420
     ctgcacaaca tgcgcacgct gcaccacatg ccgccggaga agcgcgtccg catcgcccag       480
     gaaaccctcg acatctatgc gccgctcgcc ggccgcatgg ggatgcagga gctgcgcgag       540
     gaactggagg atctctcctt ccgcaacctc aagcccgacg tctacgcgac gatcagcaag       600
     cggctcgacg acctcacgac caagtccgag agcctcgtcg agagcatcga gcgcgatctc       660
     gtccagcggc tcgcggccaa aggcatcacc gcgcaggtca gggggcgcca gaagcggccc       720
     tactccatct ggagcaagat ggagcgcaag tccgtcgcct tcgagcaatt gtcggacatc       780
     ttcggcttcc gggtcgtggt cgattcggtc gacacctgct accgggcact cggcgtcgtg       840
     cacacgacct ggccgatggt gccggggcgc tacaaggact acatctcgac cccgaagcag       900
     aacgactacc ggtcgatcca caccacggtg atcgggccga agagccagcg cgtcgaactg       960
     cagatccgaa ccgccgagat ggacgaggtg gcggagtacg gcatcgccgc gcatgccctc      1020
     tacaaggacg gctcgcccca tctcgccacc gagagcggcg cctatcagtg gctgcgccgc      1080
     accatcgagc tcctcgccga gggcgacagc ccggaagaat tcctggagca caccaagctc      1140
     gaactcttcc aggatcaggt cttctgcttc acgccgaagg gccggctgat cgcgctgccg      1200
     cgtggggcga cgccgatcga tttcgcctac gcggtccata ccgagctcgg caacgccgcg      1260
     gtcggcgcca agatcaacgg gcgcatcgcg ccgctcctca ccgagctgca gaacggcgac      1320
     gaggtcgaga tcgtgcgggc ggacggtcag accccgcccg cggcctggga atccctcgtc      1380
     gtcaccggca aggcgcgggc ggcgatccgg cgggcgacgc gctcggcggt gcggcggcaa      1440
     tatgcggggc tcgggcgcca gatcctcgac cgcgccttcg agcgcgccgg caagaatttc      1500
     tccgacgaga agctgcgcgg cgccctcccc cgcctcgccc gcacctccgc cgaggacgtc      1560
     ttcgcggcgg tgggccgggg cgagatgttc tcaggggacg tcgtgaaggc ggtctatccc      1620
     gactacaagg acgagcggcg cagccagtct gccgccacgg ggcccaagcc ccacgtcaac      1680
     ggggcgggcc gcctctccct cgacaaggac cagacggtgc gcctgacctg gcccggcaag      1740
     gggcgcggcg aggaagacga gggcgcgatc ccgatccgcg gcctcgaccg cgacctgccg      1800
     gtgcgcttcg cgcccgaggg cggcgcggtg ccgggcgacc gcatcgtcgg catcctcacg      1860
     cccggcgagg gcgtgaccat ctacccgatc cagtccccgg ccctcgccgc cttcgacaac      1920
     gagcccgacc gctggctcga cgtgcgctgg gacgtggacg gcggctcgaa tcagcgcttc      1980
     ccggcccgca tcgccctgca atccatcaac gagcccggca gcttcgccca gatcgcccag      2040
     gtgatcgccg accacgacgg caacatcgac aacatctcga tgaagcggcg cagccaggac      2100
     ttcaccgatg tcctcatcga cctgtcggtc tgggacctga agcacctcaa cgcgatcgtc      2160
     tcggagctgc gggccaagcg cgtggtgagc cgggtcgagc gggtgaacgg gtga            2214
//

If you have problems or comments...

PBIL Back to PBIL home page