(data stored in ACNUC7421 zone)

EMBL: CP001349.PE320

CP001349.PE320       Location/Qualifiers
FT   CDS_pept        372241..373464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0328"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: met:M446_2274 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55372"
FT                   /db_xref="GOA:B8IAX9"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAX9"
FT                   /inference="protein motif:PFAM:PF00070"
FT                   /protein_id="ACL55372.1"
FT                   /translation="MGGIVVVGTGQGGFQLGASLREGGYQGPVTLIGDEPGLPYGRPPL
FT                   SKAYLMGKTDAAGLLLRAPGYYAEHGLTIRSGERVAALDRAAQRVELASGERLPFDHLV
FT                   LATGARNRPLPVPGADLPGVHQLRSLAEADALKAALAGVTRVAVVGAGFIGLEFAAVCS
FT                   SKGLSVTVIEGLDRALARAVSPIMAGAITASHEAAGARLLFGAQVEAIAGRERATGVVI
FT                   RGGGTVEADLVLIGIGVLPNQDLAEAAGLPMGNGIEVDAMLSTADPAVSAIGDCASHPS
FT                   PHADGARVRLESVQNAVDGARCVAARLTGRPAAYTAVPWFWSDQGPLKLQIAGLSTPAD
FT                   AAVTRGAPGASFSVFRYREGRLVCVESLNRPADHMIARRLLQAGTSLSPEQAADPGFDL
FT                   KAFALTSA"
     atgggaggca tcgtcgtggt gggcaccggc cagggcggct tccagctcgg cgcctccctg        60
     cgcgagggcg gataccaggg acccgtgacg ctcatcggcg acgagccggg cctgccctac       120
     ggacgcccgc cgctctccaa ggcctacctg atggggaaga ccgatgcggc cggcctgctg       180
     ctgcgggcac ccggctatta tgccgagcac gggctcacga tccggtccgg cgagcgggtg       240
     gcggcgctcg accgtgcggc gcagcgggtc gagctcgcct cgggcgagcg gctgcccttc       300
     gaccatctcg tcctcgcgac gggcgcgcgc aaccgcccgc tgcccgtgcc gggcgccgac       360
     ctccccggcg tgcatcagct gcgcagcctc gcggaggccg acgcgctcaa ggccgccctc       420
     gccggggtca cccgggtggc cgtcgttggc gccggcttca tcgggctcga attcgcggcc       480
     gtctgctcca gcaaggggct gtccgtcacg gtgatcgagg ggctggaccg ggcgcttgcc       540
     cgggcggtct cgcccatcat ggcgggcgcc atcacggcct cgcacgaggc ggcgggcgcg       600
     cgcctcctgt tcggggcgca ggtggaggcg atcgcggggc gcgagcgggc gacgggcgtc       660
     gtcatccggg gcggcgggac ggtggaggcc gacctcgtcc tcatcggcat cggggtgctg       720
     ccgaaccagg atctcgccga ggccgccggc ctgccgatgg ggaacggcat cgaggtcgac       780
     gcgatgctct cgaccgccga ccccgcggtc tcggcgatcg gcgactgcgc ctcccatccc       840
     tcgccccatg cggacggcgc ccgggtgcgc ctcgaatcgg tgcagaacgc agtcgacggc       900
     gcccgctgcg tggcggcccg gctcaccggc cggccggccg cctatacggc ggtgccctgg       960
     ttctggagcg accagggccc cctgaagctc cagatcgccg gcttgagcac gcccgccgat      1020
     gcggccgtga cccgcggcgc gccgggggcg agcttctcgg tcttccgcta ccgggagggc      1080
     cgcctggtct gcgtcgagtc cctcaaccgc cccgccgacc acatgatcgc gcggcgcctg      1140
     ctccaggccg gcacgagcct cagccccgag caggcggccg atcccggctt cgacctgaag      1200
     gccttcgcgc tcacctccgc ctga                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page