(data stored in ACNUC7421 zone)

EMBL: CP001349.PE321

CP001349.PE321       Location/Qualifiers
FT   CDS_pept        complement(373472..373774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0329"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2273 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55373"
FT                   /db_xref="GOA:B8IAY0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAY0"
FT                   /inference="similar to AA sequence:KEGG:M446_2273"
FT                   /protein_id="ACL55373.1"
FT                   /translation="MNGGNDITAGQVRRARDLLGWSEADLALHANVDAAVIRHFETGTY
FT                   PPSRGQRDALRGALVAAGVTFTDTGDPGARLRGSGPVNDGIHPRELTTENDDGTS"
     gtgaacggcg ggaacgacat cacggcggga caggtgcggc gggcgaggga cctgctcgga        60
     tggtcggagg cggatctcgc cctgcatgcc aatgtcgacg cggcggtgat ccgccacttc       120
     gagacgggca cctatcctcc gtcgcgcgga cagcgggacg cgctccgggg tgccctggtc       180
     gcggccggcg tgacgttcac cgacaccggc gaccccggcg cgcgcctgcg cggcagcggt       240
     ccggtgaatg acggcatcca cccgcgcgag ctcaccaccg agaacgacga cgggacgagc       300
     tga                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page