(data stored in ACNUC7421 zone)

EMBL: CP001349.PE322

CP001349.PE322       Location/Qualifiers
FT   CDS_pept        374046..374534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0330"
FT                   /product="protein of unknown function DUF306 Meta and HslJ"
FT                   /note="PFAM: protein of unknown function DUF306 Meta and
FT                   HslJ; KEGG: met:M446_2272 protein of unknown function
FT                   DUF306 MetA and HslJ"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55374"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAY1"
FT                   /inference="protein motif:PFAM:PF03724"
FT                   /protein_id="ACL55374.1"
FT                   /translation="MMAMRMAAAAGAVALVAFATQASAQAILGYGQKNRDKPDQKQYIP
FT                   PAKAQEKIFPLDSTWTAVSLNGRPFAGADRPSFIIDKQYRARGFGGCNTFAATAFPLKE
FT                   QHLAVGPLAITKKSCDKAVSAAEMQFFTAFRTSAQWDIVGSQLVIKSQAGELRFDRAL"
     atgatggcga tgcggatggc ggctgccgcc ggtgccgtcg cgctcgtggc gtttgccact        60
     caggcgtcgg cgcaggcgat cctgggatac gggcagaaga accgcgacaa gccggatcag       120
     aagcagtaca tcccgcctgc caaggcgcag gagaagatct tcccgctgga ttccacctgg       180
     acagccgtga gcctgaacgg caggccgttc gcgggggcgg atcgtccgag cttcatcatc       240
     gacaagcagt accgcgcgcg cggtttcggc ggctgcaaca ccttcgcggc gacggccttc       300
     ccgctcaagg agcagcacct cgcggtgggc ccgctcgcca tcaccaagaa gtcctgcgac       360
     aaggccgtga gcgccgccga gatgcagttc ttcacggcgt tccgcacctc cgcgcagtgg       420
     gacatcgtcg gctcgcagct ggtcatcaag tcccaggccg gcgagctgcg cttcgaccgc       480
     gcgctctga                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page