(data stored in ACNUC7421 zone)

EMBL: CP001349.PE323

CP001349.PE323       Location/Qualifiers
FT   CDS_pept        374787..375920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0331"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   met:M446_2271 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55375"
FT                   /db_xref="GOA:B8IAY2"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAY2"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ACL55375.1"
FT                   /translation="MRVLMRGLVAAALLAGAVTGAAAQDKTPVKLGAIEILTGPNSRYG
FT                   IAIQRGFDLAAAEINKGGGVLGGRPLALVYEDSAGAKEQALNAARKLIGRDKVPLILGP
FT                   TLSNEMFAAGPVANERKVPIVGTSTTANGITAIGPYVFRTSLPEADVIPVTLRTAKEKF
FT                   GIKRVAVMYGNDDAFTKSAYDVMKGALDKLGIEVLTTETFGSKDTDFSAQLTKIKGLNP
FT                   DAIVLSALVEAASGIALQARQLGIDPKVFIIGGNGLNSPKLGEIAGAAADGTIVGSPWF
FT                   IGKKDPANQAFVASFREKYGDSPDQFAAQAYDTLFIVAKAIDAAGAPESEKIKDALIKV
FT                   KHTGVMGPFSFSESRDPADTSGVVVLTMKGGKFQLLE"
     atgcgtgtgc tgatgagagg attggtggcc gcggccctgc tggccggggc cgtgacggga        60
     gctgcggctc aggacaagac gccggtgaag ctcggcgcca tcgagatcct gaccggtccc       120
     aacagccgct acgggatcgc gatccagcgc ggcttcgatc tcgccgcggc cgagatcaac       180
     aagggtggcg gcgtgctggg cggtcggccg ctcgcgctcg tctacgagga ttcggccggc       240
     gccaaggagc aggcactcaa cgccgcccgc aagctcatcg gccgggacaa ggttccgctg       300
     atcctcggcc ccaccctttc gaacgagatg ttcgccgcag gcccggtcgc caacgagcgc       360
     aaggtcccga tcgtcggcac ctccaccacc gcgaacggca tcacggcgat cggcccctac       420
     gtgttccgca cctcgctgcc ggaggcggac gtcatcccgg tgacgctccg caccgcgaag       480
     gagaagttcg gcatcaagcg cgtcgccgtg atgtacggca acgacgacgc cttcaccaag       540
     tcggcctacg acgtgatgaa gggcgcgctg gacaagctcg gcatcgaggt gctgaccacc       600
     gagaccttcg gctccaagga caccgacttc tcggcccagc tcaccaagat caagggcctg       660
     aaccccgacg cgatcgtgct gtcggcgctg gtcgaggcgg cctccggcat cgccctccag       720
     gcccggcagc tcggcatcga cccgaaggtg ttcatcatcg gcggcaacgg cctgaactcg       780
     cccaagctcg gcgagatcgc gggcgcggcg gccgacggca ccatcgtcgg aagcccctgg       840
     ttcatcggca agaaggaccc ggcgaatcag gccttcgtgg cctccttccg ggagaagtac       900
     ggcgacagcc ccgaccagtt cgccgcccag gcctacgaca cgctgttcat cgtagcgaag       960
     gccatcgacg ccgccggggc gcccgaatcc gagaagatca aggatgcgct gatcaaggtg      1020
     aagcataccg gcgtgatggg tccgttctcg ttctcggaga gccgcgatcc ggcggacacg      1080
     tccggcgtgg tggtgctcac catgaagggc ggcaagttcc agctgctgga gtga            1134
//

If you have problems or comments...

PBIL Back to PBIL home page