(data stored in ACNUC7421 zone)

EMBL: CP001349.PE324

CP001349.PE324       Location/Qualifiers
FT   CDS_pept        376143..377024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0332"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   met:M446_2270 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55376"
FT                   /db_xref="GOA:B8IAY3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAY3"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACL55376.1"
FT                   /translation="MLEQQLVNGVVLGATYALFAIGFTLMFGVMGVINLTYGVYFAIGA
FT                   FAALWSTQSLNLGIAAALPVGALVAGLIAVAIDTALLTRLRKAKAPELASLMVTLGATL
FT                   FLYAGLAAWLGTEIRRFPAAIFEGGAYSLGSIRIGTTQILIVGAAIAFVIALMALVRGS
FT                   RLGLAIRAVAENPDAAALMGINGGLMLRVVSFLSGAIGGAAGVLVGLNFNAIQPFMGEH
FT                   MMLRGFAVIIVGGLGDLRGALVAGLLLGFAEVLTAAYLSSTFKDLTAFALLVATLWFRP
FT                   MGLFGRAAAKRA"
     atgcttgagc agcagctcgt caacggcgtc gtcctcgggg cgacctacgc cctcttcgcc        60
     atcggcttca cgctgatgtt cggcgtgatg ggcgtcatca acctgaccta cggcgtctat       120
     ttcgcgatcg gcgccttcgc ggccctgtgg tcgacgcaga gcctgaacct cggcatcgcc       180
     gccgccctgc cggtcggagc cctggtcgcg ggcctgatcg cggtggcgat cgacacggcg       240
     ctcctcaccc ggctgcgcaa ggccaaggcg ccggaactcg cctccctgat ggtgaccctc       300
     ggcgccacgc tcttcctcta tgcgggcctt gccgcgtggc tcggcaccga gatccggcgc       360
     tttcccgccg caatcttcga gggcggcgcc tacagcctcg gcagcatccg catcggcacc       420
     acccagatcc tgatcgtcgg cgccgctatc gccttcgtga tcgccctgat ggcgctggtg       480
     cgcggctcgc gcctcggcct cgccatccgg gccgtcgccg agaacccgga cgcggccgcg       540
     ctgatgggca tcaatggcgg gctgatgctg cgcgtcgtgt ccttcctgtc gggcgccatc       600
     ggaggcgcag cgggcgtgct cgtcggcctc aacttcaacg ccatccagcc cttcatgggc       660
     gagcacatga tgctgcgggg cttcgcggtg atcatcgtgg gcggcctcgg ggacctgcgc       720
     ggggccctgg tggccggcct gctcctcggc tttgccgagg tgctgaccgc cgcctatctg       780
     tcctcgacct tcaaggacct caccgccttc gcgctcctgg tggcgaccct gtggttccgg       840
     cccatgggcc tgttcggccg cgcggccgcc aagcgggcct ga                          882
//

If you have problems or comments...

PBIL Back to PBIL home page