(data stored in ACNUC7421 zone)

EMBL: CP001349.PE325

CP001349.PE325       Location/Qualifiers
FT   CDS_pept        377030..377875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0333"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   met:M446_2269 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55377"
FT                   /db_xref="GOA:B8IAY4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAY4"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACL55377.1"
FT                   /translation="MWEALDDFYWTYQSLIHGIGVNGLLALSIYVVLAVGQLSLGQAAF
FT                   MGVGAYTGALLTVKFGTPFAVSMAAAAAVPALIALVVGGPTLRLTGVYLAIATIGLGEI
FT                   TRIVFLNWDYAGGALGLSGIPERGGVGAIYGTLAVVLVGLILVARSRVGRAMEAMREDE
FT                   AAAGVMGVNLPRYRMTALVVSSALAGIAGCLSAHVSSFIGPNEYGFETAVTILSYALLG
FT                   GIGSPVAPVLGAAILTLLPEVLRPLADFRLMVNGLIIVIAVLFMPRGILPWRIARTGAR
FT                   "
     atgtgggagg ccctcgacga tttctactgg acctatcaga gcctcatcca cggcatcggg        60
     gtgaacgggc tcctggcgct ctcgatctac gtggtgctgg cggtgggcca gctctcgctc       120
     gggcaggcgg ccttcatggg cgtcggcgcc tatacggggg cgctgctgac cgtgaagttc       180
     ggcacgccct tcgcggtctc gatggccgcc gccgcggcgg tgccggcgtt gatcgccctc       240
     gtggtcggcg gcccgaccct gcggctcacc ggcgtctacc tcgccattgc gacgatcggg       300
     ctcggcgaga tcacccgcat cgtcttcctc aactgggatt acgcgggcgg ggcgctcggg       360
     ctctccggca tccccgagag gggcggggtc ggggcgatct acggcacgct cgcggtcgtg       420
     ctcgtcggcc tcatcctggt cgcgcgctcg cgcgtcgggc gggccatgga ggcgatgcgc       480
     gaggacgagg cggcagccgg cgtgatgggc gtgaacctgc cgcgctaccg catgaccgcc       540
     ctcgtggtct cctccgccct cgccggcatc gcgggctgcc tctcggccca tgtctcctcc       600
     ttcatcggcc cgaacgagta cgggttcgag accgccgtga ccatcctcag ctacgccctc       660
     ctcggcggca tcggctcgcc cgtggcgccg gtcctcggcg ccgcgatcct caccctgctg       720
     cccgaggtgc tgcgcccgct cgcggatttc cgcctcatgg tgaacggcct catcatcgtg       780
     atcgccgtgc tgttcatgcc gcggggcatc ctgccctggc gcatcgcccg gacgggggcc       840
     cgatga                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page