(data stored in ACNUC7421 zone)

EMBL: CP001349.PE326

CP001349.PE326       Location/Qualifiers
FT   CDS_pept        377872..378672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0334"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: met:M446_2268 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55378"
FT                   /db_xref="GOA:B8IAY5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAY5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55378.1"
FT                   /translation="MSMPAPSLLVAEGLTRRFQGLVAVDGVDLAVREGNVHGLIGPNGA
FT                   GKTTLFNLLSGVLAPTAGSVRLDGRALDGLPPYRRTALGLARTFQNIRIFTEMTVLENV
FT                   MTGMHARLSSGLGILLRSPGFRAEERAAKARARELLAFVGLAEAAERRAGSLPYGDQRR
FT                   LEIARALACEPRLVLLDEPAAGMNPADTHALLGLLRRLRDERGLTLLLVEHDMPLVMSL
FT                   CDRLTVLNFGRRIADGTPAEVRAHPAVIEAYLGTKAAIPQGAAS"
     atgagcatgc cggccccttc cctgctggtg gccgagggcc tgacccgccg cttccagggc        60
     ctcgtcgccg tcgatggcgt ggatctcgcg gtgcgcgagg gcaatgtcca tggcctgatc       120
     ggcccgaacg gagcgggcaa gaccaccctg ttcaacctgc tctcgggggt gctcgccccc       180
     acggccggca gcgtgcgcct cgacgggcgc gccctcgacg gcctgccgcc ctaccggcgc       240
     acggccctcg ggctcgcccg caccttccag aacatccgca tcttcaccga gatgacggtg       300
     ctggagaacg tgatgaccgg catgcatgcg cggctgtcgt ccgggctcgg catcctcctg       360
     cgcagccccg gcttccgggc ggaggagcgg gccgccaagg cgcgcgcccg cgagcttctc       420
     gccttcgtgg gcctcgccga ggcggcggag cggcgcgccg gcagcctgcc ctacggcgac       480
     cagcggcggc tggagatcgc ccgggcgctc gcctgcgagc cgcgcctcgt cctcctcgac       540
     gagccggcag cgggcatgaa cccggccgat acgcatgcgc tcctcggcct gctgcggcgg       600
     ctgcgcgacg agcgcggcct caccctgctc ctcgtcgagc acgacatgcc cctggtcatg       660
     agcctgtgcg accgcctcac cgtgctgaat ttcggccgcc gcatcgcgga cgggacgccc       720
     gcggaagtgc gcgcccaccc ggccgtgatc gaggcctatc tcggcaccaa ggcggcgatc       780
     ccgcagggag cggcctcgtg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page