(data stored in ACNUC7421 zone)

EMBL: CP001349.PE327

CP001349.PE327       Location/Qualifiers
FT   CDS_pept        378669..379418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0335"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: met:M446_2267 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55379"
FT                   /db_xref="GOA:B8IAY6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAY6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55379.1"
FT                   /translation="MSALLSVTGLRLGYGRADVVHGLDLTVTEGRIVSLIGSNGAGKTT
FT                   ILRGLSGLLKPRAGEIRWGGQAGEGTSGGNLPGLDLAGEPAHRIARRGIVQVPEGRQVF
FT                   ANMTVAENLRLGAYRASHAEAARRQQAVVARFPRLGERLSQQAGYLSGGEQQMLAMGRA
FT                   LMAEPKLLLLDEPSMGLAPLIVDEIFSIIAALRAEGRTILLVEQNAGAALAIADDAYVL
FT                   ETGRIRLQGPAAEVARNPEVAAAYLGL"
     gtgagcgcgc tcctcagcgt gaccggcctg cgcctcggct acggccgggc cgacgtggtg        60
     cacgggctcg acctcacggt cactgagggc cggatcgtct cgctgatcgg ctcgaacgga       120
     gcgggcaaga ccacgatcct gcgcggcctc tcggggctcc tgaagccccg cgcgggcgag       180
     atccgttggg gcggccaagc gggcgagggt acttcgggcg ggaacctccc gggcctggac       240
     ctggcgggcg agcccgccca ccgcatcgcc cgccgcggca tcgtgcaggt gccggaaggt       300
     cggcaggtct tcgccaacat gacggtggcc gagaacctgc ggctcggcgc ctatcgggcg       360
     agtcatgccg aggctgcgcg gcggcagcag gccgtggtgg cgcgatttcc ccggctcggc       420
     gagcggctct cccagcaggc cggctatctg tcgggcggcg agcagcagat gctcgccatg       480
     ggccgcgccc tgatggccga gcctaagctc cttctcctcg acgagccctc gatgggcctc       540
     gctccgctca tcgtggatga gattttttcc atcatcgcgg cgctgcgggc cgagggccgc       600
     acgatcctgc tcgtggagca gaatgccggc gccgcgctcg ccatcgcgga cgacgcctat       660
     gtgctggaga ccggccgcat ccgcctccag ggcccggccg ccgaggtggc ccgcaatccg       720
     gaggtggcgg cggcctatct gggcctttga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page