(data stored in ACNUC7421 zone)

EMBL: CP001349.PE328

CP001349.PE328       Location/Qualifiers
FT   CDS_pept        379557..380714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0336"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   bra:BRADO5530 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55380"
FT                   /db_xref="GOA:B8IAY7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAY7"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACL55380.1"
FT                   /translation="MRERVVPWQEVSVIDNRAEFVGLAQQEAANVAALCRRFGISRKTG
FT                   YKWLGRARSGAGLDDRSRRPHASPARTSPEMEEAVLELRTAHPSWGGRKLRRRLQDQGQ
FT                   EVVPAASTITAVLARHARLGQPDAPSIPFTRFEHPRPNALWQMDFKGHFAHAGGRCHPL
FT                   TVLDDHSRYALCLAACADEVTATVQGQLSATFRRYGLPERINLDNGSPWGNGPGQRYTP
FT                   LTVWLLRLGIHISHSRPYHPQTNGKDEGFHRTLKRDVLHGAFYASLAACQRAFDRFRLI
FT                   YNCSSERTSRYAVDAKRLCCAGSGTAGCLLRFSVPCARARAAGLSRAARLNTQGPSARG
FT                   CTASTSPRSAARRSVRAATPTRAAAWLRFSQGSSPSAPARNTGMR"
     atgcgggagc gtgtcgtgcc ttggcaagag gtgtcagtca tagacaaccg cgccgagttc        60
     gtgggtctgg cccagcagga ggcggcgaac gtggcggcgc tgtgccgccg cttcgggatc       120
     agccgcaaga ctggctacaa gtggctgggc cgggcgcgga gtggcgcggg cttggacgac       180
     cgctcgcggc gcccgcacgc cagcccggcc cgcacgtccc ccgagatgga ggaggcggtg       240
     ctggaactgc gcacggctca tccgagttgg ggtgggcgca agctgcgccg acggctgcag       300
     gatcagggcc aggaggtggt cccggccgcc tcgacgatca ccgccgtgct ggcgcgccac       360
     gcccggctgg gccaacccga tgcccccagc atcccgttca cccgcttcga gcacccccgg       420
     cccaacgctc tctggcagat ggacttcaag ggccacttcg cccatgccgg cggccgctgc       480
     caccctctca ccgtgctgga cgaccacagc cgctacgcgc tctgcctggc ggcctgtgcc       540
     gacgaggtca ccgcgaccgt gcaggggcag ctgagtgcca cgttccggcg ctacggcctg       600
     cccgagcgga tcaacctgga caacggcagc ccctggggca acggaccggg ccagcgctac       660
     acgcctctca ccgtgtggct gctgcggctg ggcatccaca tcagccacag ccggccctac       720
     catccgcaga ccaacggcaa ggacgagggc ttccatcgca ccctcaagcg cgacgtgctg       780
     catggcgcgt tctacgccag cctggcggcc tgccagcggg cgttcgatcg cttccggctg       840
     atctacaatt gctcatcaga acgcacatct cgctatgctg ttgatgcgaa gaggctttgc       900
     tgcgccggat ccggtaccgc ggggtgtttg ctgcggttca gcgtcccctg cgcgagggcc       960
     cgggcggccg ggctgtcgag agcggctcgg ctgaacaccc agggtccgtc tgcgagagga      1020
     tgcaccgcat cgacctcgcc ccgttccgcc gccagacgaa gcgtgcgcgc ggccaccccg      1080
     acgagggcgg ctgcctggct caggttcagc cagggctcct ctccctctgc gcccgcgcgg      1140
     aacaccggaa tgcggtag                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page