(data stored in ACNUC7421 zone)

EMBL: CP001349.PE329

CP001349.PE329       Location/Qualifiers
FT   CDS_pept        380730..381425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0337"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55381"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAY8"
FT                   /inference="similar to AA sequence:KEGG:PFDG_03179"
FT                   /protein_id="ACL55381.1"
FT                   /translation="MTRSRVKRLPCPVLTPLRLSTPAITSSRAISASARTASTTSAGVL
FT                   VRWPRRRRGRRCSVWAPPTQCSVSTISARASSRSATASWRTVRTIRFLSRASVVGADQI
FT                   PRRSAASVSSAAGARAGRGVAASCSAMRASQAPTRARARFQRASSSPVTRRFSGSAASY
FT                   CRKARSAAKRAASRSRTMAARASSRRVFACASAARAASTAAGCTTDRSADSTTSSTRRP
FT                   PKAMQFGSP"
     gtgacgcgct cgcgcgtgaa gcggttgccg tgccctgtcc tcacgccgtt gcgattgagc        60
     acgcccgcga tcacgtcgtc acgcgcgatc agcgccagcg cgcgcacggc ctcaaccacg       120
     tcggcgggcg tgctggtgcg ctggccgcgc cggcggcgtg gcaggcggtg ctcggtgtgg       180
     gcgccgccca cccagtgcag cgtcagcacg atctcggccc gcgcctcgtc gaggtcagca       240
     acggcctcgt ggaggacagt gcgcacgatc cgcttcttga gccgggcatc cgttgtcggt       300
     gccgaccaga taccgcgcag gtccgcggcc agcgtctcga gcgccgcagg agcgagggcg       360
     ggccgcggag tggccgcttc gtgctcggcg atgcgcgcct cgcaagcgcc cactcgggcc       420
     agagcccggt tccaacgcgc ctcgagttcg ccggtcacca ggcggttctc gggatcagcg       480
     gcatcgtact gccggaaggc gcggtcggcc gcgaagcgtg ccgcctccag gtcgcgcacc       540
     atggccgcgc gggcctcgtc gcgccgcgtg ttcgcctgtg cctcggccgc tcgcgccgcc       600
     tcaaccgcgg ccggctgcac gacagacagg agcgctgact ccaccacgtc gtcgacgcgc       660
     aggcccccaa aggcgatgca gttcggctcg ccgtag                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page