(data stored in ACNUC7421 zone)

EMBL: CP001349.PE33

CP001349.PE33        Location/Qualifiers
FT   CDS_pept        35063..35653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0034"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /note="TIGRFAM: orotate phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase; KEGG: met:M446_0032 orotate
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55085"
FT                   /db_xref="GOA:B8IT23"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR006273"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8IT23"
FT                   /inference="protein motif:TFAM:TIGR01367"
FT                   /protein_id="ACL55085.1"
FT                   /translation="MTPDDLLEEFRAAGALLEGHFILSSGLHSAVFLQKMAIFSDPVRT
FT                   ERVCAGLAALIRARYGAVDIVVSPAIGGIVPGYETARALGARAIFVERDPGGPFQLRRG
FT                   FSIPAGARAVMVEDIVTTGLSSRECLAALKAEPGEIVGAACLIDRSGGRADLGAPLVAL
FT                   ATLDIPNYPADQLPPELAAIPAVKPGSRAMKAS"
     atgacgccag acgacctgct cgaagaattc cgcgccgcgg gcgcgctcct cgaaggccac        60
     ttcatcctct cgtcgggcct gcacagcgcg gtcttcctgc agaagatggc gatcttcagc       120
     gatccggtgc gcacggagcg ggtctgcgcg ggcctcgccg cgctgatccg cgcgcgctac       180
     ggcgccgtgg acatcgtggt ctcgccggcg atcggcggca tcgtgccggg ctacgagacc       240
     gcgcgcgcgc tcggcgccag ggcgatcttc gtcgagcgcg accccggcgg cccgttccag       300
     ctgcggcgcg gcttcagcat cccggccggc gcccgggccg tgatggtcga ggacatcgtc       360
     acgaccggcc tctcctcgcg ggaatgcctc gccgccctga aggcggagcc cggcgagatc       420
     gtcggggcgg cctgcctcat cgaccgctcg ggcggccggg ccgatctcgg tgcgcccctg       480
     gtggccctcg ccaccctcga catcccgaac tacccggccg atcagcttcc gcccgaactc       540
     gccgcgatcc cggccgtgaa gcccggaagc cgcgccatga aggcgagctg a                591
//

If you have problems or comments...

PBIL Back to PBIL home page