(data stored in ACNUC7421 zone)

EMBL: CP001349.PE330

CP001349.PE330       Location/Qualifiers
FT   CDS_pept        complement(381330..382487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0338"
FT                   /product="Resolvase domain protein"
FT                   /note="PFAM: Resolvase domain; Recombinase; KEGG:
FT                   acr:Acry_3392 resolvase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55382"
FT                   /db_xref="GOA:B8IAY9"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAY9"
FT                   /inference="protein motif:PFAM:PF00239"
FT                   /protein_id="ACL55382.1"
FT                   /translation="MSAEKIGPQHRARKAVLYVRQSSAHQVQHNRESQALQYAMRERLA
FT                   GLGFAEIEVIDEDLGCSAAGGTPRAGFERMVAEVCLGKVGAVAAREVSRFARNSRDWQQ
FT                   LVEMCRVVDTLLVDQETIYAPRLGNDRLLLGLKGSLNEYELDLLRQRSLAARYEKAHRG
FT                   ELVVAAPVGFIKVGARLEMDPDRRVQAAIRLAIDKVAELGSVRQALLWFLEHGLDLPTR
FT                   VNAGPVVWRRPRYSTLRAFIANPAYGGAYAYGRSRVTASYDAAGAKARARRTPRSEWLA
FT                   LKPGAHEGYVAWERAEAIRAMVSENVPASSRGAPKLGAALLSGLRPLRAQAERAVHGGQ
FT                   GTDPALRLRARADRLRRAELHRLWGPARRRRGGVSAPVCRAAGRG"
     atgagcgctg agaagatcgg cccgcagcac cgggcccgca aagccgtgct ctacgtccgc        60
     cagtcctcgg cgcatcaggt ccagcacaac cgtgagagcc aggcgctgca gtacgccatg       120
     cgcgagcggc ttgcggggct cggctttgct gagatcgagg tgatcgacga ggacctcggc       180
     tgctcggccg ccggcgggac gccccgcgcc ggcttcgagc gcatggtcgc cgaggtgtgc       240
     ctgggcaagg tcggcgcggt cgccgcccgt gaggtctcgc gctttgcccg caacagccgc       300
     gactggcagc agctcgtgga gatgtgccgc gtcgtcgata ccctgcttgt tgatcaggag       360
     acgatctacg cgcctcgcct cggcaacgac cgcctgctcc tggggctcaa gggcagcctc       420
     aacgagtacg agctcgacct tctgcgccag cgctcgctgg cggcgcgcta cgagaaggcc       480
     caccgcggcg agctcgtggt cgcggccccc gtgggcttca tcaaggtcgg agcccggctc       540
     gagatggatc ctgatcggcg cgtgcaggcg gcgatccggc ttgccatcga caaggtggcc       600
     gaactcggca gcgtgcgtca ggcgctgctc tggttcctgg agcacgggct cgatctgccg       660
     acccgcgtca acgccggtcc ggtcgtctgg cgccgccccc gctactcgac gcttcgcgcg       720
     ttcattgcca atcccgccta tggcggcgcc tacgcctacg gtcgcagccg cgtcaccgcc       780
     agctacgacg cggccggagc caaggcgcgg gcgcggcgca cgcctcgttc ggaatggctg       840
     gcgttgaagc ctggcgcgca tgaaggttac gtggcgtggg agcgggcgga ggcgatccgg       900
     gcgatggtga gcgagaacgt cccggcaagt tcccgcggcg cgcccaagct cggcgcggcg       960
     ctgctctcgg ggctgcggcc gctgcgggcg caagctgaac gtgcagtaca cgggggccaa      1020
     gggacagatc ccgcgctacg cctgcgtgcg cgggcggatc gactacggcg agccgaactg      1080
     catcgccttt gggggcctgc gcgtcgacga cgtggtggag tcagcgctcc tgtctgtcgt      1140
     gcagccggcc gcggttga                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page