(data stored in ACNUC7421 zone)

EMBL: CP001349.PE331

CP001349.PE331       Location/Qualifiers
FT   CDS_pept        382893..382994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55383"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAZ0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55383.1"
FT                   /translation="MGASASEQRAAAPVVRSITSWTQTARPAHGCHA"
     atgggcgcgt ccgcgagcga gcagcgcgcc gccgcgccgg tcgtgcgctc gatcacctcg        60
     tggacgcaga cggcgcgccc ggcccacggg tgccacgcgt ag                          102
//

If you have problems or comments...

PBIL Back to PBIL home page