(data stored in ACNUC7421 zone)

EMBL: CP001349.PE332

CP001349.PE332       Location/Qualifiers
FT   CDS_pept        383831..384028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0341"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2266 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55384"
FT                   /db_xref="GOA:B8IAZ1"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAZ1"
FT                   /inference="similar to AA sequence:KEGG:M446_2266"
FT                   /protein_id="ACL55384.1"
FT                   /translation="MQQGRTPGAAARGDAPPLLRPHGLVHGRYAAAPAFDRTALMAASL
FT                   GAAFGTGLLALIGLAARAAL"
     atgcaacagg gtcggacgcc tggagcggcg gcgcgggggg acgcgccgcc gctcctcaga        60
     ccacacgggc tcgtccacgg gcgctacgcg gccgctccgg ccttcgaccg cacggcgctg       120
     atggcagcgt ccctcggagc cgcgttcgga accggtcttc tcgccctgat cggcctcgcc       180
     gcccgcgcgg cgctctga                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page