(data stored in ACNUC7421 zone)

EMBL: CP001349.PE333

CP001349.PE333       Location/Qualifiers
FT   CDS_pept        384075..385346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0342"
FT                   /product="TRAP transporter solute receptor, TAXI family"
FT                   /note="TIGRFAM: TRAP transporter solute receptor, TAXI
FT                   family; KEGG: met:M446_2265 TRAP transporter solute
FT                   receptor TAXI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55385"
FT                   /db_xref="GOA:B8IAZ2"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAZ2"
FT                   /inference="protein motif:TFAM:TIGR02122"
FT                   /protein_id="ACL55385.1"
FT                   /translation="MMRRHVPITIATLLALLAAGLLVYQWAWLPTTLRVAVGPPGGEDA
FT                   RMIGAVAQSLARGHEDVRLRVMPTSGVAESAAVAGREKADLAVVRSDIGIPASTQTVAI
FT                   LHRDAAVLMTADPALAAVPDLKDRRVGVVRQQVGNAKLLATILEQYEVPPGSVETVPLA
FT                   HGDEAGRALQEGRVDAVFVVAPVTGSTMTEAVASIVRAGLHLTFIPVGEAAAIVRRSPA
FT                   LEAVEVGRGTFGGTPSRPAEAFTTLGVSHRLVAQAKLPDAIVSELTRLLFVTRPAIVGE
FT                   VPLANQIEAPETDKGASLPLHPGAEAYFDGEIETFFERYGDWFYLIVMCLSILGSAAAT
FT                   LVSRAANRSRARDMELLRELLAIVRASRDVENEDDLFGLEHKADEILAAALARAGTGAI
FT                   DNAGVAAFTLGLDQAGGLSPSAAF"
     atgatgcgcc gccacgtccc gatcaccatc gcgaccctgc tcgccctcct ggccgcgggg        60
     ctccttgtct accaatgggc gtggctgccg acgacgctgc gcgtcgcggt cggtcccccg       120
     ggcggcgagg atgcgcggat gatcggggcc gtcgcgcagt cgctcgcccg cggccacgag       180
     gatgtgcgcc tgcgggtcat gccgacgagc ggcgtcgccg agagcgcggc cgtggccggg       240
     cgcgagaagg ccgacctcgc ggtggtgcgc tccgatatcg gcattccggc ctcgacccag       300
     accgtcgcca tcctccaccg cgacgccgcg gtgctgatga ccgccgatcc ggccctcgcc       360
     gccgtgccgg acctgaagga ccgccgggtc ggtgtggtgc gccagcaggt cgggaacgcg       420
     aagctcctcg ccactatcct cgaacaatac gaggtcccgc ccggcagcgt cgagacggtg       480
     cccctcgccc acggcgacga ggcgggccgg gcgctgcagg aggggcgggt cgatgccgtg       540
     ttcgtggtcg cgcccgtcac ggggtcgacc atgacggagg cggtcgccag catcgtgcgg       600
     gcgggactgc acctcacctt cattccggtg ggcgaggcgg cggccatcgt ccggcgctcc       660
     cccgccctcg aagccgtgga ggtcggacgc ggcaccttcg gcgggacgcc ctcgcggccg       720
     gccgaggcct tcaccacgct cggggtcagc caccgcctag tggcgcaggc gaagctcccc       780
     gacgccatcg tctcggaact gacgcgcctt ctcttcgtga cccggccggc catcgtcggc       840
     gaggtgccgc tcgccaacca gatcgaggcc ccggagacgg acaagggcgc ctccctgccc       900
     ctgcatccgg gcgccgaagc ctatttcgat ggggagatcg agaccttctt cgagcgctac       960
     ggcgactggt tctacctgat cgtgatgtgc ctctcgatcc tgggctcggc cgccgcgacc      1020
     ctggtctccc gggcggcgaa ccgctcgcgc gcccgcgaca tggaattgct gcgagaactc      1080
     ctcgccatcg tgcgggcgag ccgggacgtg gagaacgagg acgacctgtt cgggctggag      1140
     cacaaggccg acgagatcct ggcggcggcg ctcgcgcggg ccggcaccgg ggcgatcgac      1200
     aatgcgggcg tcgccgcctt cacgctcggc ctcgaccagg ccggcgggct atcgccgagc      1260
     gccgcattct ga                                                          1272
//

If you have problems or comments...

PBIL Back to PBIL home page