(data stored in ACNUC7421 zone)

EMBL: CP001349.PE334

CP001349.PE334       Location/Qualifiers
FT   CDS_pept        385532..387355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0343"
FT                   /product="GTP-binding protein TypA"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein TypA; PFAM: elongation factor G domain protein;
FT                   protein synthesis factor GTP-binding; elongation factor Tu
FT                   domain 2 protein; KEGG: met:M446_2264 GTP-binding protein
FT                   TypA"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55386"
FT                   /db_xref="GOA:B8IAZ3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAZ3"
FT                   /inference="protein motif:TFAM:TIGR01394"
FT                   /protein_id="ACL55386.1"
FT                   /translation="MKLRNIAIIAHVDHGKTTLVDKLLQQSGSFRENQRVEERVMDSND
FT                   LEKERGITILAKVTSVVWKDTRVNIVDTPGHADFGGEVERILSMVDGVIVLVDAAEGPM
FT                   PQTKFVVSKALKIGLRPIVAINKVDRPDARIDEVVNEVFDLFAALDATDEQLDFPILYG
FT                   SGRNGWMATSPDGPQDGMAPLFDLVLDHVPPAKTEDGAFRMLGTLLEANPFLGRIVTGR
FT                   IASGSVKPNQTIKVLDRTGKVVETGRVSKILAFRGLERQPIEVGEAGDIVSVAGLTKGT
FT                   VSDTFCDPSVETPIQAQPIDPPTVTMSFIVNDSPLAGTEGDKVTSRMIRDRLFKEAEGN
FT                   ITLKIEEAADKDSFHVSGRGELQLSILIETMRREGFELAVSRPRVVFEKDEAGNLLEPI
FT                   EEVVIDVDEEHSGVVVQKMSERKGDMLEMRPSGGNRLRLVFHAPTRGLIGYQSELLTDT
FT                   RGTAIMNRLFKAYEPFKGEIPGRRNGVLISNDQGEAVAYALWNLEDRGPMMIEPGWKVY
FT                   QGMIVGEHNRENDLEVNVLKGKKLTNIRTTSKDEAVRLTPPIRMTLERSLAWIQDDELV
FT                   EVTPKSIRLRKTVLDPNDRKRAERSKEALSA"
     atgaagctgc gcaacatcgc catcatcgcc cacgtcgacc acgggaagac caccctggtc        60
     gacaagctcc ttcagcaatc ggggtccttc cgcgagaacc agcgcgtcga ggagcgcgtg       120
     atggactcga acgacctgga gaaggagcgc ggcatcacca tcctggccaa ggtgacctcc       180
     gtggtctgga aggacacccg ggtcaacatc gtcgacaccc ccggccacgc ggatttcggc       240
     ggcgaggtcg agcgcatcct ctcgatggtc gacggcgtga tcgtgctcgt cgacgcggcc       300
     gaggggccga tgccgcagac caagttcgtg gtctcgaagg ccctcaaaat cggcctcagg       360
     cccatcgtcg ccatcaacaa ggtcgaccgg ccggatgccc gcatcgacga ggtggtcaac       420
     gaggtcttcg atctcttcgc ggccctcgac gccaccgacg agcagctcga cttcccgatc       480
     ctctacggct cgggccgcaa cggctggatg gcgacctcgc cggacggccc gcaggacggc       540
     atggcgccgc tcttcgacct cgtcctcgac cacgtgcctc cggcgaagac cgaggacggc       600
     gccttccgca tgctgggcac gctgctcgaa gccaacccgt tcctcggccg gatcgtcacc       660
     gggcgcatcg cctcgggcag cgtcaagccg aaccagacca tcaaggtcct cgaccgcacc       720
     ggcaaggtgg tggagacggg ccgggtctcg aagatcctcg ccttccgcgg cctggagcgc       780
     cagccgatcg aggtcggcga ggcgggcgac atcgtgtcgg tcgcgggcct taccaagggc       840
     accgtgtccg acaccttctg cgatccctcc gtcgagacgc cgatccaggc tcagccgatc       900
     gatccgccga ccgtgacgat gtccttcatc gtgaacgatt cgccgctcgc cggcaccgag       960
     ggcgacaagg tcacgagccg catgatccgc gaccgcctgt tcaaggaggc ggagggcaac      1020
     atcaccctca agatcgagga ggcggcggac aaggattcgt tccacgtctc gggccgcggc      1080
     gagctgcagc tctcgatcct gatcgagacc atgcgccgcg agggcttcga actcgccgtg      1140
     tcgcgtccgc gcgtggtgtt cgagaaggac gaggccggca acctcctgga gccgatcgag      1200
     gaggtggtga tcgacgtcga cgaggagcat tccggcgtcg tcgtgcagaa gatgtcggag      1260
     cgcaagggcg acatgctgga gatgcggccc tcgggcggca accgcctgcg cctcgtcttc      1320
     catgccccga cccgcggcct catcggctat cagagcgagc ttctgaccga cacccgcggc      1380
     accgcgatca tgaaccggct gttcaaggcc tacgagccct tcaagggcga gatcccgggc      1440
     cggcgcaacg gcgtgctgat ctcgaacgac cagggcgagg ccgtggccta cgcgctctgg      1500
     aacctggagg atcgcggccc gatgatgatc gagcccggct ggaaggtcta ccagggcatg      1560
     atcgtgggcg agcacaaccg cgagaacgac ctcgaggtga acgtgctcaa gggcaagaag      1620
     ctcacgaaca tccgcaccac ctcgaaggac gaggcggtgc ggctgacgcc gccgatccgc      1680
     atgacgctgg aacgctcgct cgcctggatc caggacgacg agctcgtcga ggtcacgccg      1740
     aaatccatcc gcctgcgcaa gaccgtgctc gatccgaacg accgcaagcg ggccgagcgc      1800
     tcgaaggagg cgctgagcgc ctga                                             1824
//

If you have problems or comments...

PBIL Back to PBIL home page