(data stored in ACNUC7421 zone)

EMBL: CP001349.PE335

CP001349.PE335       Location/Qualifiers
FT   CDS_pept        complement(387652..389091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0344"
FT                   /product="protein of unknown function UPF0061"
FT                   /note="PFAM: protein of unknown function UPF0061; KEGG:
FT                   mex:Mext_4180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55387"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAZ4"
FT                   /inference="protein motif:PFAM:PF02696"
FT                   /protein_id="ACL55387.1"
FT                   /translation="MPARPSRRHAELGPDFYDVVAPARFPQAIIRHRNQAWAARVGLGG
FT                   LTDEEWIAHFARFEPMEGSFPEPLALRYHGHQFRSYNPDLGDGRGFLFAQLHDLRDGRL
FT                   LDLGTKGSGQTPYSRFADGRLTLKGGLREVLATTMLEALGVDTSKSFSLIETGESLERS
FT                   DEPSPTRASVLVRLSHSHIRIGSFQRPRALGRTEEIRRLLDHTIRTYMPGLWHEDVGTR
FT                   AASFLAEVCRLVVRTGAQWMAAGFVHGVLNTDNINVTGESFDYGPWRFAPVNDPGFTAA
FT                   YFDEFGLYAFGRQPEALAWNLGRLAECLLPLSDIDRLGAALDVIGPSLQDSFAEAILRR
FT                   LGLARPEDEDRLHALVGAFWAFLRESRAPFEQVFFDWYGGSLSTARAARSPAAEHYAGE
FT                   TFARVRDLLPAFAPAPDIRLDHPYFARSTPCTMLIDEVEAVWAPIAERDDWSAYEAKMR
FT                   AIAEMAEAYGTAPQAVGDPAA"
     atgcccgccc gaccgtcccg ccgccacgcc gaactcggcc ccgatttcta cgacgtggtc        60
     gcgccggccc gcttcccgca ggcgatcatc cgccaccgca accaggcctg ggccgcccgc       120
     gtcggcctcg gcgggctcac ggacgaggaa tggatcgcgc atttcgcccg gttcgagccc       180
     atggagggca gtttcccgga gccgctggcg ctgcgctatc acggccacca gttccgctcc       240
     tacaacccgg atctcggcga cggccgcggc ttcctgttcg cgcaactgca cgacctgagg       300
     gatgggcgcc tcctcgacct cggcaccaag ggcagcgggc agacgcccta ttcgcgcttc       360
     gccgacggcc gcctgaccct gaagggtggc ttgcgcgagg ttttggccac caccatgctg       420
     gaggcgctcg gcgtcgacac ctcgaaatcc ttcagcctga tcgagaccgg cgagagcctc       480
     gagcgcagcg acgagccctc gccgacgcgc gcctcggtgc tggtgcgtct cagccactcg       540
     catatccgca tcggcagctt ccagcgtccg cgggcgcttg gccgcacgga ggagatccgc       600
     cggctcctcg accacacgat ccgcacctac atgccggggc tctggcacga ggatgtcggc       660
     acgcgcgcgg cctccttcct ggcggaggtc tgccgtcttg tggtgcgcac gggcgcgcag       720
     tggatggcgg cgggcttcgt gcacggcgtg ctcaacaccg acaacatcaa cgtgacgggc       780
     gagagcttcg attatgggcc ctggcgcttc gcgcccgtga acgatccggg tttcaccgcg       840
     gcctatttcg acgagttcgg cctctacgcc ttcggccgcc agcccgaggc gctggcctgg       900
     aatctcgggc gcctcgccga gtgcctgctg ccgctctccg acatcgaccg cctgggggcg       960
     gccctcgatg tcatcggccc atccctgcag gattccttcg cggaggcgat cctgcggcgc      1020
     ctcggcctcg ccaggccgga ggacgaggat cggctgcatg cgctggtggg cgccttctgg      1080
     gccttcctgc gcgagagccg cgcccccttc gagcaggtgt tcttcgactg gtacggcggc      1140
     tccttgagca cggcgcgcgc ggcccgcagc cccgcggcgg agcattatgc gggcgagacc      1200
     ttcgcgcggg tgcgcgacct gttgccggcc ttcgcgccgg caccggacat ccggctcgac      1260
     catccgtatt tcgcacggtc cacgccctgt acgatgctga tcgacgaggt cgaggctgta      1320
     tgggcgccga tcgcggaacg cgacgactgg tcggcctatg aggcgaagat gcgggccatc      1380
     gccgagatgg ccgaggccta cgggacggcg ccgcaggccg tcggtgaccc tgccgcatga      1440
//

If you have problems or comments...

PBIL Back to PBIL home page