(data stored in ACNUC7421 zone)

EMBL: CP001349.PE336

CP001349.PE336       Location/Qualifiers
FT   CDS_pept        complement(389161..389847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0345"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: met:M446_2263
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55388"
FT                   /db_xref="GOA:B8IAZ5"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAZ5"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ACL55388.1"
FT                   /translation="MADDSFDSVATAIRTRRAVRAFRSDPVPRETVTALLDLAAQAPSG
FT                   SNMQPWRAYAVAGKARARLCEAVVAAYLAGEKGEPAARYYPEEFFEPYRTRRRRVGLGL
FT                   YALVGIPKGDAARMQAQHARNFRFFDAPVGLIFTIDRRLATGSWLDYGGFLQTLMIAAR
FT                   ARGLDTCPQAAFAPFDAVIRRHLPLGPDEAVVCGMALGYADPQAPENRLVPEREPAAGF
FT                   ATLLGF"
     atggccgatg attctttcga ttccgtggcg acggcgatcc ggacccgccg ggcggtgcgg        60
     gccttccggt cggatcccgt gccgcgcgag acggtgacgg cgctgctcga cctcgccgcc       120
     caggcgccga gcggcagcaa catgcagccc tggcgggcct atgcggtggc cgggaaggcg       180
     cgcgcgcggc tctgcgaggc cgtggtggcg gcctatctgg ccggcgagaa gggcgagccc       240
     gccgcccgct actatccgga ggagttcttc gagccctatc gcacgcggcg gcgccgtgtc       300
     ggcctcgggc tctacgcgct cgtcggcatc ccgaagggcg acgcggcccg aatgcaggcg       360
     cagcacgccc gcaatttccg cttcttcgac gcgccggtgg ggctgatctt caccatcgac       420
     cgccgcctcg ccacgggcag ctggctcgat tacgggggct tcctgcagac gctgatgatc       480
     gccgcccggg ctcgggggct cgacacctgc ccgcaggccg ctttcgcccc gttcgatgcg       540
     gtgatccggc gccatctgcc gctcggaccc gacgaggccg tcgtctgcgg catggcgctg       600
     ggctatgccg atccgcaggc gcccgagaac cggctggtgc ccgagcgcga gcccgccgcg       660
     ggtttcgcca cgctgctcgg cttctga                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page