(data stored in ACNUC7421 zone)

EMBL: CP001349.PE337

CP001349.PE337       Location/Qualifiers
FT   CDS_pept        390146..390874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0346"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; Ribonuclease B
FT                   OB region domain; SMART: Cold shock protein; KEGG:
FT                   met:M446_2262 cold-shock DNA-binding domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55389"
FT                   /db_xref="GOA:B8IAZ6"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAZ6"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ACL55389.1"
FT                   /translation="MGRGRDFREPRRRGFDDGAPEPRWPDQAPSGGGYGGGGGGYGGGF
FT                   GGGFDRGPSRSSIPSGPERDATVKWFNKEKGFGFVELGDGSGDAFLHIRAVEAAGHTDL
FT                   LPGTRLTVQTAQGQKGPQVTNITSVDTSTAEAPAARGPRPPRAGGFGGGGGYGGGGGGG
FT                   GGGRFASGPATEMSGTVKWYDPAKGFGFVSVKDGGKDVFVHRSALARAGLDSLAEGQQV
FT                   TMDVVEGQKGREAQSISVAE"
     atgggacgtg gtcgtgattt tcgggagccg cgtcgtcgcg gcttcgatga tggtgctcct        60
     gagccgcggt ggccggatca ggcgccatcc ggggggggat acggtggcgg tggcggtggc       120
     tacggcggcg gtttcggtgg cggtttcgac cgcggcccgt cgcgcagcag cattccctcc       180
     gggccggagc gtgatgcgac ggtcaagtgg ttcaacaagg agaaaggctt cgggttcgtc       240
     gagctgggtg acggttcggg cgatgccttc ctccatatcc gcgccgtcga ggcggccggt       300
     cataccgacc tcctgcccgg cacgcgcctg accgttcaga cggcccaggg gcagaagggc       360
     ccgcaggtga ccaacatcac cagcgtcgac accagcacgg ccgaggcccc ggcggcccgc       420
     gggccgcgcc cgccccgcgc gggcggcttc ggtggcggcg gcggctacgg cggcggtggc       480
     ggcggtggtg gcggtgggcg cttcgccagc ggccccgcga ccgagatgag cgggaccgtg       540
     aagtggtacg atcccgccaa gggcttcggc ttcgtctcgg tgaaggacgg cggcaaggac       600
     gtgttcgtcc atcgctccgc cctcgcccgg gccggcctcg actccctggc cgagggccag       660
     caggtgacga tggacgtggt cgagggccag aaaggccgcg aggcgcagag catctccgtc       720
     gcggagtga                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page