(data stored in ACNUC7421 zone)

EMBL: CP001349.PE338

CP001349.PE338       Location/Qualifiers
FT   CDS_pept        390883..391185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0347"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mrd:Mrad2831_0145 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55390"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAZ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55390.1"
FT                   /translation="MSKLFAKRRFLGAAASCVLGLAAGAARAEDFTGFYAGVNVGYGRS
FT                   LGDGDGRMTRPGALPSPAGDATALPPSAARAATGNPALRPRGRGPTISASSGARP"
     gtgtcgaaac ttttcgcgaa gcggcggttc ctcggagccg ccgcttcgtg cgttctgggc        60
     ctcgccgcgg gtgcggcgcg cgccgaggac ttcacgggct tctatgccgg ggtgaatgtc       120
     ggatacgggc ggagcctggg cgacggggac gggcggatga cgcggcccgg cgctctcccc       180
     tcccctgcgg gcgacgcgac cgccctgccg ccgagcgcgg cccgggcggc gaccggcaac       240
     ccggccctgc ggccgcgcgg gcgcgggcct acgatttctg cttcttctgg agcgcgtcct       300
     tga                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page