(data stored in ACNUC7421 zone)

EMBL: CP001349.PE339

CP001349.PE339       Location/Qualifiers
FT   CDS_pept        complement(391151..391420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0348"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2261 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55391"
FT                   /db_xref="GOA:B8IAZ8"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAZ8"
FT                   /inference="similar to AA sequence:KEGG:M446_2261"
FT                   /protein_id="ACL55391.1"
FT                   /translation="MTGDLNEEPLAPATAVAPPPKLTRREMRRQRRRRRIIGEEILAWI
FT                   LVPLILIAGYWALSGGLAFFGTTPSAVFDQLLQVKDALQKKQKS"
     atgaccggcg atctcaacga ggagcccctc gctccggcga ccgcggtcgc gccgccgccc        60
     aagctcaccc gccgcgagat gcggcgccag cgccgccgcc gccgcatcat tggcgaggag       120
     atcctggcct ggatcctcgt gcccctgatc ctgatcgccg gttactgggc gttgagcggc       180
     gggctggcct tcttcggcac cacgccgagc gccgtgttcg accagctcct tcaggtcaag       240
     gacgcgctcc agaagaagca gaaatcgtag                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page