(data stored in ACNUC7421 zone)

EMBL: CP001349.PE34

CP001349.PE34        Location/Qualifiers
FT   CDS_pept        35854..36513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0035"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88; KEGG:
FT                   met:M446_0033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55086"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT24"
FT                   /inference="protein motif:PFAM:PF01936"
FT                   /protein_id="ACL55086.1"
FT                   /translation="MTYQRSALFIDGANVYATTKALGFDIDYRKLLADFKARENLIRAF
FT                   YYTALVEDQEYSSIRPLIDWLDYNGYRVVTKPAKEFTDSSGRRKVKGNMDIELTIDALE
FT                   LSPYIDHMVLFSGDGDFKPLVAAMQRRGVRVTVVSTIQTQPPMVADDLRRQADDFVDIV
FT                   HLIPRIGRDQSDRPTRPLRPAPAGEGLRENGERSPVRPSATLEQRYGIRQDETEED"
     atgacatatc aacgcagcgc cctcttcatc gacggcgcta atgtgtacgc gacgaccaag        60
     gctctcggat tcgacatcga ttatcgaaag ctgctcgcgg atttcaaggc gcgcgaaaac       120
     cttatcaggg cgttttacta tacggcactg gtcgaagatc aggaatactc gtcgattcgg       180
     ccgttgatcg actggctgga ttataacggc taccgggtgg tgacgaagcc cgcgaaggaa       240
     ttcacggact cgagcggccg ccgcaaggtc aagggcaaca tggacatcga actcacgatc       300
     gatgccctgg agctcagtcc ctatatcgac cacatggtcc tgttctccgg ggacggcgac       360
     ttcaagccgc tcgtcgccgc gatgcagcgg cggggcgtgc gggtgacggt ggtctccacc       420
     atccagaccc agccgccgat ggtggccgac gatctgcgca ggcaggccga cgatttcgtc       480
     gacatcgtcc acctgatccc gcgaatcggt cgcgaccaga gcgaccgtcc gacccggccg       540
     ctgcgcccgg ctccggccgg cgaggggctg cgcgagaacg gcgagcgcag ccccgtgcgg       600
     ccctcggcga ccctggagca gcgctacggg atccgtcagg acgagaccga ggaggattga       660
//

If you have problems or comments...

PBIL Back to PBIL home page