(data stored in ACNUC7421 zone)

EMBL: CP001349.PE340

CP001349.PE340       Location/Qualifiers
FT   CDS_pept        complement(391587..394040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0349"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   clpA"
FT                   /note="KEGG: met:M446_2260 ATP-dependent Clp protease,
FT                   ATP-binding subunit ClpA; TIGRFAM: ATP-dependent Clp
FT                   protease, ATP-binding subunit clpA; PFAM: AAA ATPase
FT                   central domain protein; Clp domain protein; ATPase
FT                   associated with various cellular activities AAA_5; ATPase
FT                   AAA-2 domain protein; ATP-dependent Clp protease
FT                   ATP-binding subunit clpA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55392"
FT                   /db_xref="GOA:B8IAZ9"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR013461"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAZ9"
FT                   /inference="protein motif:TFAM:TIGR02639"
FT                   /protein_id="ACL55392.1"
FT                   /translation="MPSFSRSLEQALHRALALAGERRHEYATLEHLLLALVDDQDAAAV
FT                   MRACNVDVELLKRNLIEYIDTELANLTGDGRQDAKPTAGFQRVIQRAVIHVQSSGREEV
FT                   TGANVLVAIFAERESHAAYFLQEQDMTRYDAVNYISHGIAKRPGLSEAKPVRGAEEEGG
FT                   SERPSGGEDERGPKKKGDALDAYCVNLNKKAREGKIDPLIGREAEVQRTIQVLCRRQKN
FT                   NPLLVGDPGVGKTAIAEGLARKIIQHEVPEVLADATVFSLDMGTLLAGTRYRGDFEERL
FT                   KQVMKEIEAHPNAIMFIDEIHTVIGAGATSGGAMDASNLLKPALASGTLRCIGSTTYKE
FT                   YRQYFEKDRALVRRFQKIDVNEPSIPDAIEILKGLRPYFEEFHKLKYTTDAVKAAVELS
FT                   ARYISDRKLPDKAIDVIDETGASQMLVPESRRKRTIGVKEVEATIATMARIPPKTVSKD
FT                   DAVVLANLTDSLKRVVYGQDSAIEALTASIKLARAGLRDPDKPIGSYLFAGPTGVGKTE
FT                   VAKQLAVALGVEMLRFDMSEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVLL
FT                   LDEIEKAHPDLFNILLQVMDHGKLTDHNGKQVDFRNVIIIMTSNAGAQDLARAAFGFTQ
FT                   SKRTGDDQEAINRLFAPEFRNRLDAIVSFGHLPREVVSKVVDKFVLQLEAQLADRNVTI
FT                   ELSDEAREWLVENGYDETMGARPMARLIQSTIKTPLADEVLFGKLKDGGAVRVVVKRPE
FT                   TGKPSLGFEFPAGPVTPKPEKDVTNAAKKKRSRPRAAPKKPKDNGGPGGSGGVRTVPKV
FT                   PLVRA"
     ttgcccagct tctcacgcag ccttgaacaa gcactccacc gcgccctggc gctcgctggc        60
     gagcgtcgcc acgaatacgc cacgctcgaa catctcctgc tggccctggt ggatgaccag       120
     gacgcggctg cggtcatgcg ggcctgcaac gtcgatgtcg agcttctgaa gcgcaatctc       180
     atcgagtata tcgacaccga actcgccaac ctgacgggtg acggccgcca ggacgccaag       240
     ccgacggccg ggttccagcg cgtgatccag cgcgcggtga tccacgtgca atcctcgggc       300
     cgcgaggagg tcacgggggc gaatgtcctc gtcgccatct tcgccgagcg cgagagccac       360
     gccgcctatt tcctgcaaga gcaggacatg acccgctacg acgcggtcaa ttacatcagc       420
     cacggcatcg ccaagcggcc cggcctgtcg gaggccaagc ccgtgcgcgg cgccgaggag       480
     gagggcggct ccgagcggcc ctcgggcggc gaggacgagc gcggcccgaa gaagaagggc       540
     gacgccctcg acgcctattg cgtgaacctc aacaagaagg cgcgcgaggg taagatcgac       600
     ccgctgatcg gccgcgaggc cgaggtgcag cgcaccatcc aggtgctgtg ccggcgccag       660
     aagaacaacc cgctgctcgt cggcgatccc ggcgtcggca agaccgcgat cgccgaaggg       720
     ctggcgcgca agatcatcca gcacgaggtg ccggaggttc tggccgacgc cacggtcttc       780
     tccctcgaca tgggcacgct gctcgcgggc acccgctacc ggggcgattt cgaggagcgc       840
     ctcaagcagg tgatgaagga gatcgaggcg catcccaacg ccatcatgtt catcgacgag       900
     atccacacgg tgatcggcgc cggtgcgacc tcgggcggcg cgatggatgc ctcgaacctg       960
     ctcaagccgg ccttggcctc gggcacgctg cgctgcatcg gctcgacgac ctacaaggag      1020
     taccgccagt acttcgagaa ggaccgcgcc ctggtccgcc gcttccagaa gatcgacgtc      1080
     aacgagccgt cgatccccga cgcgatcgag atcctcaagg gtctgcggcc gtatttcgag      1140
     gagttccaca agctcaagta tacgaccgac gccgtgaagg cggcggtcga gctgtcggcc      1200
     cgctacatca gcgaccgcaa gctgccggac aaggcgatcg acgtgatcga cgagacgggc      1260
     gcctcgcaga tgctggtgcc ggagagccgg cgcaagcgga cgatcggcgt gaaggaggtc      1320
     gaggcgacca tcgccaccat ggcccgcatc ccgccgaaga ccgtgtcgaa ggacgacgcg      1380
     gtggtgctgg ccaatctcac cgacagcctc aagcgcgtcg tctacggcca ggacagcgcc      1440
     atcgaggcgc tcaccgcctc gatcaagctc gcccgcgcgg gcttgcgcga ccccgacaag      1500
     ccgatcggct cctatctgtt cgccggcccc acgggcgtcg gcaagaccga ggtcgccaag      1560
     cagctcgccg tcgcgctcgg ggtcgagatg ctgcgcttcg acatgtcgga atacatggag      1620
     cgccacacgg tctcgcggct gatcggcgcg ccgcccggct atgtcggctt cgaccagggc      1680
     ggcctgctca ccgacggcgt cgaccagcac ccgcattgcg tcctgctgct cgacgagatc      1740
     gagaaggcgc atccggacct gttcaacatc ctgctgcagg tcatggatca cgggaagctg      1800
     accgaccata acgggaagca ggtcgatttc cgcaacgtca tcatcatcat gacgtcgaat      1860
     gcgggcgccc aggacctcgc ccgggcggcc ttcggcttca cgcagagcaa gcgcaccggg      1920
     gacgaccagg aggccatcaa ccgcctgttc gctccggaat tccgcaaccg gctcgatgcg      1980
     atcgtgtcct tcggtcacct gcccagggag gtggtctcga aggtggtcga caagttcgtg      2040
     ctccagctcg aggcgcagct cgccgaccgc aacgtcacga tcgagctctc ggacgaggcg      2100
     cgcgagtggc tggtcgagaa cggctacgac gagaccatgg gtgcccgccc gatggctcgc      2160
     ctgatccagt cgaccatcaa gacgccgctc gcggacgaag tgctattcgg caagctcaag      2220
     gacggcggcg cggtgcgggt ggtcgtgaag cggccggaga ccggcaagcc gtcgctcggc      2280
     ttcgagttcc cggccggccc ggtgacgccg aagcccgaga aggatgtgac gaacgcggcc      2340
     aagaagaagc gctcccgtcc gcgcgcggcg ccgaaaaagc cgaaggacaa tggcggtccg      2400
     ggcggcagcg ggggcgtgcg gacggtgccg aaggtgccgc tcgtgcgggc ctga            2454
//

If you have problems or comments...

PBIL Back to PBIL home page