(data stored in ACNUC7421 zone)

EMBL: CP001349.PE341

CP001349.PE341       Location/Qualifiers
FT   CDS_pept        complement(394062..394469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0350"
FT                   /product="ATP-dependent Clp protease adaptor protein ClpS"
FT                   /note="PFAM: ATP-dependent Clp protease adaptor protein
FT                   ClpS; KEGG: met:M446_2259 ATP-dependent Clp protease
FT                   adaptor protein ClpS"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55393"
FT                   /db_xref="GOA:B8IB00"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR022935"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB00"
FT                   /inference="protein motif:PFAM:PF02617"
FT                   /protein_id="ACL55393.1"
FT                   /translation="MSQVPRQDIVVIKRAAAAEIVAASPRAPGNGGNGGDGRSGTAVIT
FT                   RTRPITKRPNLYRVLLLNDDYTPMEFVVHVVERFFNKSREDATRIMLHVHQNGVGECGV
FT                   FTYEVAETKVTQVMDFARKHQHPLQCVMEKK"
     atgtctcaag tcccgcggca ggacatcgtc gtcatcaaaa gggccgctgc ggccgagatc        60
     gtcgcggcgt cgcctcgcgc ccccggcaat ggcggcaatg gcggggacgg ccgctcggga       120
     accgccgtca tcacgcgcac ccggccgatc accaagcggc cgaacctcta ccgcgtgctc       180
     ctgctcaacg acgactacac gcccatggag ttcgtcgtcc acgtggtgga gcgcttcttc       240
     aacaagtcgc gcgaggacgc gacccgtatc atgctgcacg ttcatcagaa cggcgtcggc       300
     gaatgcggcg tgttcacgta cgaggtggcg gagaccaagg tgacgcaggt gatggacttt       360
     gcccgcaaac accaacatcc tctgcaatgc gtcatggaaa agaaatag                    408
//

If you have problems or comments...

PBIL Back to PBIL home page