(data stored in ACNUC7421 zone)

EMBL: CP001349.PE342

CP001349.PE342       Location/Qualifiers
FT   CDS_pept        complement(394791..395129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0351"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2258 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55394"
FT                   /db_xref="InterPro:IPR010127"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB01"
FT                   /inference="similar to AA sequence:KEGG:M446_2258"
FT                   /protein_id="ACL55394.1"
FT                   /translation="MNQQFETAQKYGKESMDSLLRSFGTLSKGSQAIAVEAADFVKQSI
FT                   EQTTATLEKLAGVRSLDKAIEIQTEYLKTSYERFLAQSTKMAELYGNLAKEMVKPLESF
FT                   AAKVPAAA"
     atgaatcagc aattcgagac ggctcagaag tacggcaagg agagcatgga ctccctgctg        60
     cgcagcttcg gcacgctgtc gaagggcagc caggccatcg cggtcgaggc ggccgatttc       120
     gtcaagcagt ccatcgagca gaccaccgcg acgcttgaga agctcgccgg cgtgcgctcg       180
     ctcgacaagg cgatcgagat ccagaccgag tacctgaaga cctcctacga gcgcttcctg       240
     gcccagtcga cgaagatggc cgagctctat ggcaacctcg ccaaggagat ggtgaagccg       300
     ctcgagtcct tcgccgccaa ggttccggcc gcggcgtaa                              339
//

If you have problems or comments...

PBIL Back to PBIL home page