(data stored in ACNUC7421 zone)

EMBL: CP001349.PE343

CP001349.PE343       Location/Qualifiers
FT   CDS_pept        395421..396917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0352"
FT                   /product="peptidase S11 D-alanyl-D-alanine carboxypeptidase
FT                   1"
FT                   /EC_number="3.4.16.4"
FT                   /note="PFAM: beta-lactamase; peptidase S11
FT                   D-alanyl-D-alanine carboxypeptidase 1; Sporulation domain
FT                   protein; KEGG: met:M446_2257 serine-type D-Ala-D-Ala
FT                   carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55395"
FT                   /db_xref="GOA:B8IB02"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB02"
FT                   /inference="protein motif:PFAM:PF00768"
FT                   /protein_id="ACL55395.1"
FT                   /translation="MRGVRGTSGRAVPALIAAAAILTAMTNPADARRRGHHHGGGGGYN
FT                   PPFAAMVVDVKSGRILHAVNEDALRHPASITKVMTLYLLFEQLERGRMSLDTPLEISAN
FT                   AARQAPSKLGLRPGATITVEEAIKALVTKSANDVACAIGENIAGSEGAFAEMMTRKAHA
FT                   LGMTRTHYANASGLPDSDQITTARDLTILARAIQDRFPRYYRYFQTRSFAFRGRVIGNH
FT                   NHLLGRVEGVDGIKTGYTRDSGFNLMTSARINDRHIVAVVLGGKSVASRDAIMTRLVEA
FT                   NLPKAYAGARTTAPVVEVAERPRPAVVAEKPVATRTLVAAADGEDESIETTASTGRPGQ
FT                   PLDLNPSRQTATPSGGRWRSGSGLPANAQAYAATPDTSFPAPGGKYGSRLPSTEPGEVR
FT                   APAPPARTEAPAPKPVSVTPWVIQLGAMDDEAKAKSMLAEARQRSGGMLAKAAPFTERV
FT                   THGGTTLYRARFSGFSEAESAQDACRALKRNGFTCFATRS"
     atgcgtggcg ttcgcggcac ctctggtcgt gcagttccgg ccctgatcgc agccgcagcg        60
     atcctcaccg ccatgacgaa ccctgcggat gcccgcaggc gagggcatca ccatggcggg       120
     ggcggcggat acaatccccc gttcgcggcg atggtggtgg acgtgaagag cggccgcatc       180
     ctgcacgcgg tcaacgagga cgcgctgcgc caccccgcct cgatcaccaa ggtgatgacg       240
     ctctacctgc tgttcgagca gctggagcgg ggcaggatgt ccctcgacac gccgctcgag       300
     atctccgcca acgcggcgcg gcaggcgccc tccaagctcg gcctgcgccc cggcgcgacg       360
     atcaccgtcg aggaggcgat caaggcgctg gtgacgaaat ccgccaacga cgtggcctgc       420
     gccatcggcg agaacatcgc gggttcggag ggcgccttcg ccgagatgat gacccgcaag       480
     gcgcatgcgc tcggcatgac ccggacgcac tacgccaatg cgtcgggcct gcccgattcc       540
     gaccagatca ccacggcgcg cgacctgacg atcctggccc gggcgatcca ggaccgcttc       600
     ccgcgctact accgctactt ccagacccgc tccttcgcct tccggggccg ggtcatcggc       660
     aaccacaacc acctgctcgg gcgggtcgag ggggtcgacg ggatcaagac cggctacacg       720
     cgcgattccg gcttcaacct gatgacctcg gcgcggatca acgaccggca catcgtcgcg       780
     gtcgtcctgg gcggcaagtc cgtggcgagc cgcgacgcga tcatgacgcg gctcgtcgaa       840
     gcgaacctgc cgaaggccta tgcgggagcg cgcacgaccg cgcctgtggt ggaggtggcc       900
     gagcggcccc gccccgcggt ggtcgccgag aagccggtcg ccacgcgcac gctcgtcgcc       960
     gcggcggacg gagaggacga gtccatcgag acgaccgcct cgacgggccg cccgggccag      1020
     cccctcgacc tcaatccctc gcggcagacg gcgacgccga gcggcggccg ctggcgcagc      1080
     ggctccggcc ttccggccaa tgcccaggcc tatgcggcga cccccgacac gtccttcccg      1140
     gcgccgggcg gcaagtacgg gtcgcgcctg ccctcgaccg agcccggcga ggtccgggcc      1200
     ccggcgccgc cggcgcgcac ggaggcgccc gcgcccaaac ccgtctcggt caccccctgg      1260
     gtcatccagc tcggcgccat ggacgacgag gcgaaggcga agtcgatgct ggccgaggcg      1320
     cgccagcgca gcggcggcat gctcgccaag gccgcgccct tcaccgagcg cgtcacccat      1380
     ggcggcacca cgctctatcg cgcccgcttc tccggcttct cggaggccga gagcgcgcag      1440
     gatgcctgcc gggccctcaa gcgcaacgga ttcacctgct tcgcgacgcg gagctga         1497
//

If you have problems or comments...

PBIL Back to PBIL home page