(data stored in ACNUC7421 zone)

EMBL: CP001349.PE344

CP001349.PE344       Location/Qualifiers
FT   CDS_pept        complement(397099..397824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0353"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein; KEGG:
FT                   met:M446_2256 heat shock protein DnaJ domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55396"
FT                   /db_xref="GOA:B8IB03"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB03"
FT                   /inference="protein motif:PFAM:PF00226"
FT                   /protein_id="ACL55396.1"
FT                   /translation="MIALGLGVLVLVGLWWLGRQATNANPTLLARVLRRLGGWLALAVA
FT                   AVLFLRGRFDMAIALGLIGGWLLGWSQMPALPFGLGQQGPAPRSPGSTSRVRSMMIEME
FT                   LDHETGAMRGRVLAGPRAGQALDALPLPDLLALLATCRAGDPDGARLLEAYLDRRFAGW
FT                   REHAEGDADARPGAAPQPGAMTEEEAYQILGLERGASVEDVRRAHRTLMKRLHPDQGGS
FT                   DYLAARVNAAKDRLLNRHR"
     atgattgctc tcggtctcgg cgtgctggtc ctggtcggcc tgtggtggct cggccgtcag        60
     gcgacgaacg ccaatccgac cctcctggcg cgggtgctgc ggcgcctcgg cggctggctc       120
     gcgctcgcgg tggcggccgt gctgttcctg cgcgggcgct tcgacatggc gattgccctt       180
     gggctgatcg gcggctggct cctcggctgg agccagatgc ccgcgctgcc cttcggcctg       240
     gggcagcagg gacccgcgcc gcgcagcccc ggcagcacct cccgggtgcg ctcgatgatg       300
     atcgagatgg agctcgatca cgagaccggg gcgatgcggg gtcgcgttct cgccggaccg       360
     cgagccgggc aggcgctcga cgccctgccg ctgccggacc tgctcgccct cctcgccacc       420
     tgccgcgccg gcgatccgga cggagcgcgg ctcctagagg cttatctgga tcgccggttt       480
     gccggctggc gtgaacacgc tgagggcgat gcggacgcgc ggccgggcgc tgcgccgcag       540
     ccaggggcga tgacggagga ggaggcctat cagatcctgg ggcttgagcg cggggcgtcc       600
     gtggaggacg tgcgccgggc gcaccggacc ctcatgaaac ggctgcaccc ggaccagggg       660
     ggatcggact acctcgcggc gcgcgtcaac gcggccaagg accggcttct caaccgacat       720
     cgctga                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page