(data stored in ACNUC7421 zone)

EMBL: CP001349.PE345

CP001349.PE345       Location/Qualifiers
FT   CDS_pept        complement(397870..398571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0354"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2255 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55397"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB04"
FT                   /inference="similar to AA sequence:KEGG:M446_2255"
FT                   /protein_id="ACL55397.1"
FT                   /translation="MGERSVPPVPTGEAAVAAFLGEARRLAPATPAAPRLIFALDATMS
FT                   RQPTWDLACRLQAEMFAATADLGGLAVQLVYFRGFSECRASRFVADPRALTGLMTGIHC
FT                   RGGLTQIGRVLRHARAEAGKGPVKALVLVGDAVEEDLDGLCAVAGELRLLGVPAFCFQE
FT                   GGEPQAATGFAEIARLSGGAHARFDRDAPATLAGLLRAAAVYAARGLDGLRLAAREDAV
FT                   ARRLLGAMTPR"
     atgggcgagc gctccgttcc tcccgtcccg accggcgagg ccgccgtcgc ggccttcctc        60
     ggcgaggcgc ggcggctcgc gcccgccacc ccggccgccc cgcggctgat cttcgccctc       120
     gacgcgacga tgagccggca gccgacctgg gacctcgcct gccggctcca ggcggagatg       180
     ttcgcggcga cggcggatct cggcggcctc gccgtccagc tcgtctattt ccgcggcttc       240
     tccgagtgcc gcgcctcgcg cttcgtcgcc gatccgcggg cgctcaccgg tctgatgacc       300
     gggatccact gccgcggcgg cctgacccag atcggccgcg tcctgcggca cgctcgcgcg       360
     gaggccggca aggggccggt gaaagccctc gtcctcgtcg gcgacgccgt cgaggaggat       420
     ctcgacgggc tctgcgcggt cgcgggcgaa ttgaggctgc tcggggttcc ggccttctgc       480
     ttccaggagg gtggagagcc gcaggcggcg acgggcttcg ccgagatcgc ccggctgtcg       540
     ggcggcgccc atgcgcgctt cgaccgcgat gcccccgcga cgctggccgg gctgctgcgg       600
     gccgcggccg tctacgccgc gcggggactc gacgggctgc gcctcgctgc gcgagaagat       660
     gcggtggcgc gccggctcct cggcgccatg acgccgcggt ga                          702
//

If you have problems or comments...

PBIL Back to PBIL home page