(data stored in ACNUC7421 zone)

EMBL: CP001349.PE346

CP001349.PE346       Location/Qualifiers
FT   CDS_pept        complement(398587..399579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0355"
FT                   /product="methyltransferase"
FT                   /note="TIGRFAM: methyltransferase; KEGG: met:M446_2254
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55398"
FT                   /db_xref="GOA:B8IB05"
FT                   /db_xref="InterPro:IPR017804"
FT                   /db_xref="InterPro:IPR019257"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035094"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB05"
FT                   /inference="protein motif:TFAM:TIGR03438"
FT                   /protein_id="ACL55398.1"
FT                   /translation="MTAPRPHLPPAAPPAEPASRRFAEDVLAGLTAPRKHLAAKYFYDQ
FT                   QGSALFEAITRLPEYYPTRTELGILARHGAEIASALPPGAALVEFGSGSTQKLRRLLPH
FT                   LRDLAAYVPVDVSEEFLRSEAEDLGRDFPALRVAPVAADFTQLFALPPEALGAAARAGF
FT                   FPGSTIGNFEPEAAAALLRHFGATLGPQATLIVGVDLVKDKAVLDAAYDDAAGVTAAFN
FT                   LNLLARINREVGADFDLAAFAHRAFFDTALSRIEMHLVSRQAQRVTVANVPITFAAGET
FT                   IHTENSYKFTVEGFRALARSAGWEGRAVWTDPDGLFSIHALTATSIRRH"
     gtgaccgcac cgcgtcccca cctgcccccc gccgcgccgc ccgccgagcc ggcgagccgg        60
     cgcttcgccg aggatgtgct cgcgggcctc acggcgccgc gcaagcacct tgccgcgaag       120
     tacttctacg accagcaggg atccgccctg ttcgaggcga tcacgcgcct gccggaatat       180
     tatccgaccc gcaccgagct cggcatcctc gcccgccacg gggccgagat cgcctccgcc       240
     ctgccgcccg gtgccgccct ggtcgagttc ggcagcggct cgacccagaa gctgcgccgc       300
     ctgctgccgc atctgcgcga cctcgccgcc tacgtgccgg tcgacgtctc ggaggagttc       360
     ctgcgcagcg aggcggagga tctcggccgc gacttcccgg cgctccgcgt ggcgccggtg       420
     gcggcggatt tcacgcagct cttcgccctg ccgccggaag ccttaggcgc ggcggcgcgg       480
     gcgggcttct ttcccggctc cactatcggc aatttcgagc ccgaggccgc cgccgccttg       540
     ctgcggcact tcggggcgac gctcgggccg caggcgacgc tgatcgtcgg tgtcgatctc       600
     gtgaaggaca aggcggtgct cgatgccgcc tatgacgacg cggccggcgt cacggcggcc       660
     ttcaacctga acctgctcgc ccggatcaac cgcgaggtcg gggcggattt cgacctcgcc       720
     gccttcgcgc atcgcgcctt cttcgacacc gctttgtccc ggatcgagat gcacctcgtc       780
     agccggcaag cccagcgcgt cacggtggcc aatgtgccga tcaccttcgc ggccggcgag       840
     acaatccaca cggagaacag ctataagttc accgtcgagg gcttccgcgc cctggcccga       900
     tccgccggct gggaggggag ggcggtctgg accgatccgg acgggctgtt ctccatccac       960
     gcgctcaccg ccacctcgat ccggcgccac tga                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page