(data stored in ACNUC7421 zone)

EMBL: CP001349.PE347

CP001349.PE347       Location/Qualifiers
FT   CDS_pept        complement(399621..400877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0356"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   met:M446_2253 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55399"
FT                   /db_xref="GOA:B8IB06"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR017806"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB06"
FT                   /inference="protein motif:PFAM:PF03781"
FT                   /protein_id="ACL55399.1"
FT                   /translation="MAATATAQATDMRPAFPPPDVSARPVDRSAWIAAFRHVRDETERR
FT                   AAPLSPEDQQIQSMPDASPTKWHRAHTTWFFEQFLLKDRAHGYRIFDERFLYLFNSYYV
FT                   AAGPRAPRVSRGLVTRPTCEEVAAYRDHVDGAVCTLIETAPDAALAEVLAILEIGLHHE
FT                   QQHQELLLTDILHAFAQNPLSPAYDSGWRFPAPPAGGTLWLDGGIVPIGHAGGGFSFDN
FT                   ELPRHEVLLQPVALDRALVTNGEWLDFMQDGGYARPELWLSDGWATAQTEGWEAPGYWR
FT                   QAGDGVWSGMTLAGLKAIDPALPVTHVSYYEADAFARWAGCDLPTEAEWEAAARAGLDG
FT                   AFGHVWQWTRSSYSAYPGYRPVPGALGEYNGKFMVNQFVLRGSSVATPAGHSRATYRNF
FT                   FYPHQRWQFTGLRLSHGRA"
     atggcagcga ctgcgaccgc gcaggcgacg gacatgcgcc ccgcctttcc gcccccggac        60
     gtctcggccc ggcccgtcga tcggtccgcc tggatcgctg ctttccggca cgtacgcgat       120
     gagaccgagc gccgcgccgc cccgctctcc cccgaggacc agcagatcca gtccatgccg       180
     gacgcgagcc cgaccaagtg gcaccgcgcc catacgacct ggttcttcga gcagttcctg       240
     ctgaaggacc gcgcgcacgg ctaccggatc ttcgacgagc ggttcctcta cctgttcaat       300
     tcctactacg tggcggccgg gccgcgggcg ccacgggtca gccgcggcct cgtcacccgt       360
     ccgacctgcg aggaggtcgc ggcctatcgg gaccatgtcg acggcgccgt ctgcacgctc       420
     atcgagaccg ctcccgacgc ggcgctggcg gaggtgctcg ccatcctgga gatcggcctc       480
     caccacgagc agcagcacca ggaactcctg ctcaccgaca tcctgcatgc cttcgcgcag       540
     aacccgctgt cgcccgccta cgattccggt tggcgcttcc ccgcgccgcc ggccgggggg       600
     acgctgtggc tcgacggcgg gatcgtcccg atcgggcatg cgggcggcgg cttcagcttc       660
     gacaacgaac tgccccgcca cgaggtcctg ctgcagcccg tcgccctcga ccgggctctc       720
     gtgacgaacg gcgagtggct cgacttcatg caggatggcg gctacgcgcg gccggaactc       780
     tggctctcgg acggctgggc cacggcgcag accgaaggct gggaagcgcc cggctactgg       840
     cggcaggccg gggatggcgt ctggtccggc atgacgctcg cggggctgaa agccatcgat       900
     cccgcgctgc cggtcacgca tgtgagctac tacgaggccg atgccttcgc ccgctgggcg       960
     ggatgcgacc tgccgaccga ggcggaatgg gaggcggccg cccgggccgg gctcgacgga      1020
     gccttcgggc atgtctggca atggacccgc agcagctact ccgcctatcc gggctaccgc      1080
     ccggtgcccg gcgcgctcgg cgagtacaat ggcaagttca tggtcaatca gttcgtgctg      1140
     cgcggctcgt cggtggcgac gccggccggc catagccgcg cgacctaccg gaacttcttc      1200
     tatccccacc agcgctggca gttcacgggc ctcagactat ctcacggtcg agcctga         1257
//

If you have problems or comments...

PBIL Back to PBIL home page