(data stored in ACNUC7421 zone)

EMBL: CP001349.PE348

CP001349.PE348       Location/Qualifiers
FT   CDS_pept        401055..401993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0357"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="TIGRFAM: glutamate racemase; PFAM: Asp/Glu/hydantoin
FT                   racemase; KEGG: met:M446_2251 glutamate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55400"
FT                   /db_xref="GOA:B8IB07"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB07"
FT                   /inference="protein motif:TFAM:TIGR00067"
FT                   /protein_id="ACL55400.1"
FT                   /translation="MRFEGMPVQQHGRARPNELMRMRFDLLAGAGAAPLAPAMRAPAVL
FT                   VFDSGLGGLTVLAEVRRARPDARVVYAADDAAFPYGDLSEPALVARVVAVMERLIALHA
FT                   PDLVVVACNTATTLVLPALRARFAIPFVGTVPAIKPAAAATRSGLISVLATPGTVRRDY
FT                   TRELIDAYAGAYAVTLVGATRLAAFAEAELAGTPVGDDLLREEIAPCFVGAGESRTDVV
FT                   VLGCTHYPLLLRRFERLVPWPVTWIDPAPAIARRMAQLLGPAPHPAPPEDAAPVAAVFT
FT                   GGERITPSLRDALAARGMGSIAVEAMPLARQ"
     gtgcggttcg agggaatgcc cgtgcagcag cacgggcgcg cccgccccaa cgagttgatg        60
     cgcatgcgat tcgatcttct ggccggtgcc ggcgcggcgc cgctcgcgcc cgccatgcgg       120
     gcgccggccg tgctggtgtt cgattccggc ctcggcggcc tcacggtgct ggcggaggtg       180
     cggcgggccc gacccgacgc gcgggtcgtc tatgcggccg acgacgcggc cttcccgtat       240
     ggcgacctgt cggagccggc cctggtggcg cgggtggtcg ccgtgatgga gcgcctgatc       300
     gccctgcacg cccccgacct cgtggtggtc gcctgcaaca ccgcgacgac gctggtgctg       360
     cctgccctgc gggcgcgctt tgcgattccg ttcgtcggca cggttccggc gatcaagccg       420
     gccgccgccg cgacgcgctc ggggctgatc agcgtcctcg ccaccccggg cacggtgcgg       480
     cgcgactata cccgcgagct gatcgacgcc tatgcgggtg cctacgccgt caccctcgtc       540
     ggggcgacgc ggcttgccgc cttcgcggag gcggaactgg ccggcacgcc ggtgggcgac       600
     gaccttctgc gggaggagat cgccccctgc ttcgtcggcg cgggcgagag ccgcaccgac       660
     gtggtggtgc tcggctgcac gcattatccg ttgctgctgc ggcgcttcga gcggctcgtc       720
     ccctggcccg tcacctggat cgaccccgcc ccggccatcg cccggcggat ggcccagctt       780
     ctcggcccgg cgccgcaccc ggcgccgccg gaggatgcgg cgccggtggc ggcggtgttc       840
     accggcggcg agcgcatcac gccgtcctta cgcgacgcgc tcgccgcacg ggggatgggg       900
     tccatcgcgg tcgaggcgat gccgctcgcc cggcagtga                              939
//

If you have problems or comments...

PBIL Back to PBIL home page