(data stored in ACNUC7421 zone)

EMBL: CP001349.PE349

CP001349.PE349       Location/Qualifiers
FT   CDS_pept        402005..402817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0358"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2250 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55401"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB08"
FT                   /inference="similar to AA sequence:KEGG:M446_2250"
FT                   /protein_id="ACL55401.1"
FT                   /translation="MLLGLLLAPVALYGAVGAALWALQRDLIYPGARGLLHGRRDPPPG
FT                   VETISIRTADGETLRALWRAPAPGCGIVVSFHGNASMPEMHAERFVRDPWAAHGWGLIA
FT                   IAYRGYPGSTGRPSESGLIADGLAALAEAGRRAPGTPALLHGHSLGTAVAVAVAAEHPP
FT                   LGLYLEAPFDSMTAMARMRFPFLPTALLRDPYRSDRRIGAVTGPIVIVHGDDDPVIPTK
FT                   FGLRLARAAPAGTRFEVVEGDHVTLLGRKDAEAEALFRAKLPAGCVAG"
     gtgctgctgg gcctcctgct cgctccggtc gcgctctatg gcgcggtcgg ggcggcgctc        60
     tgggcgctgc agcgcgacct catctatccg ggcgcgcgcg gcctcctgca cgggcgccgg       120
     gatccgccgc ccggcgtcga gacgatcagc atccgcacgg cggatggcga gacgctgcgc       180
     gccctctggc gggcgcccgc gccgggatgc ggcatcgtcg tgagcttcca cggcaatgcc       240
     tcgatgccgg agatgcatgc cgagcgcttc gtgcgcgacc cctgggcggc ccatggctgg       300
     ggcctcatcg ccatcgcgta tcgcggctat ccgggctcga ccggccgccc gagcgagagc       360
     gggctcatcg ccgacgggct cgcggccctc gcggaagccg ggcgccgcgc ccccggcacg       420
     cccgcgctgc tgcacgggca ttccctcggc acggcggtgg cggtcgcggt ggccgccgag       480
     cacccgccgc tcggcctcta tctcgaagca cccttcgatt ccatgaccgc gatggcgcgg       540
     atgcgcttcc cgttcctgcc cacggcgctc ctgcgcgatc cctaccgctc ggaccggcgc       600
     atcggcgcgg tgacgggccc gatcgtgatc gtccacggcg acgacgatcc ggtgatcccg       660
     acgaagttcg gcctccgtct cgcgcgggcc gcgcccgccg gcacgcgatt cgaggtggtg       720
     gagggcgacc acgtcacgct gctcgggcgg aaggacgcgg aggcggaggc gctgttccgg       780
     gccaagctcc cggcgggttg cgtcgccggc tga                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page