(data stored in ACNUC7421 zone)

EMBL: CP001349.PE35

CP001349.PE35        Location/Qualifiers
FT   CDS_pept        complement(36708..37649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0036"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; NmrA family protein; Male
FT                   sterility domain; KEGG: met:M446_0034 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55087"
FT                   /db_xref="GOA:B8IT25"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT25"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACL55087.1"
FT                   /translation="MTTPLIALTGATGFIGRHLLRDLTARGYRVRVLLRRPVALPPGAS
FT                   GAVVGDLARPQNMAAALTGVDAVVHSAGLAHAMSGAPEDDYRTFNTEATRGLAQAAARA
FT                   RVRRFVFLSSIRAQSGPSAAGVLTEADAPTPTDAYGRSKLAAEEALAAVDIDFAALRPV
FT                   LVYGPGVKGNMAALLALAARPLPLPLGGLKGRRSIVSVESLADAIATVLHAPGELRRPF
FT                   IVTEAEPLTVPEMLTALRAGLGRPPGLWPVPALLFDAALRLAGRGEVRERLSGSLMARA
FT                   DALGALGWTAPRDSREGLEALARLEVAHPTSG"
     atgaccacgc ccctgatcgc gctcaccggg gccaccggct tcatcggccg gcatctgctg        60
     cgggatctca cggcgcgcgg ctaccgggtc cgcgtgctcc tgcgccggcc ggtcgcgctg       120
     ccgcccggag cgagcggcgc cgtggtcggc gacctcgccc ggccgcagaa catggcggcg       180
     gcgctcacgg gcgtcgacgc ggtggtgcat tcggccgggc tcgcccacgc catgtcgggg       240
     gcgccggagg acgattaccg gaccttcaac accgaggcga cgcgcggcct cgcccaggcc       300
     gccgcgcggg cgcgggtgcg ccgcttcgtg ttcctgtcct ccatccgcgc gcaatccggc       360
     ccctcggcag ccggcgtgct gaccgaggcc gacgcgccga cgcccaccga tgcctatggc       420
     cgctcgaagc tcgccgccga ggaggccctc gcggcggtcg atatcgactt cgcggctttg       480
     cgtccggtcc tcgtctacgg gccgggggtc aagggcaaca tggcggccct gctcgctctc       540
     gcggcgcggc cgctgcccct gccgctcggc gggctgaagg ggcgccgctc gatcgtctcg       600
     gtggagagcc tcgccgacgc catcgccacg gtgctgcacg cgccgggcga gttgcgccgg       660
     cccttcatcg tgacggaggc ggagccgctc accgtcccgg agatgctgac ggctttgcgg       720
     gccgggctcg ggcggccgcc gggcctctgg cccgtgccgg ccctcctgtt cgacgcggca       780
     cttcgcctcg cggggcgggg cgaggtgcgc gagcgcctct cgggctccct gatggcccgc       840
     gccgatgcgc tcggggctct cggctggacg gccccgcgcg acagccggga gggcctggag       900
     gcactcgccc ggctcgaggt ggctcatccg acatccggtt ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page